DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment klhl10 and AT5G28160

DIOPT Version :9

Sequence 1:	NP_001015100.2	Gene:	klhl10 / 3354863	FlyBaseID:	FBgn0040038	Length:	767	Species:	Drosophila melanogaster
Sequence 2:	NP_198168.1	Gene:	AT5G28160 / 832891	AraportID:	AT5G28160	Length:	324	Species:	Arabidopsis thaliana

Alignment Length:	74	Identity:	25/74 - (33%)
Similarity:	36/74 - (48%)	Gaps:	9/74 - (12%)

- Green bases have known domain annotations that are detailed below.

  Fly   499 GQECLDSAEYYDPVTNVWTR---------IPNMNHRRSGVSCVAFRNQLYVIGGFNGTARLSTGE 554
            |.|....::..||.:|::.|         .|||...|:..|.|.|..::||:||......::.||
plant   123 GSEVYGLSQRNDPSSNMFVRNKGDIFLCKAPNMTVARAKASAVVFNGKIYVMGGCMADESVNWGE 187

  Fly   555 RFDPDTQTW 563
            .||..||||
plant   188 VFDIKTQTW 196

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
klhl10	NP_001015100.2	BTB	72..186	CDD:279045
		PHA03098	86..610	CDD:222983	25/74 (34%)
		BACK	195..298	CDD:285009
		Kelch	347..394	CDD:128874
		KELCH repeat	385..428	CDD:276965
		Kelch	396..442	CDD:128874
		Kelch_1	431..476	CDD:279660
		KELCH repeat	432..475	CDD:276965
		KELCH repeat	479..523	CDD:276965	8/32 (25%)
		Kelch	490..536	CDD:128874	13/45 (29%)
		Kelch_1	525..570	CDD:279660	16/39 (41%)
		KELCH repeat	526..571	CDD:276965	16/38 (42%)
		Kelch_1	573..617	CDD:279660
		KELCH repeat	573..617	CDD:276965
AT5G28160	NP_198168.1	F-box	8..55	CDD:279040
		Kelch_1	158..203	CDD:279660	16/39 (41%)
		KELCH repeat	159..202	CDD:276965	16/38 (42%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG1072
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	1	1.000	-	-		X9
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	3	2.810