Sequence 1: | NP_001015100.2 | Gene: | klhl10 / 3354863 | FlyBaseID: | FBgn0040038 | Length: | 767 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_195920.1 | Gene: | AT5G03000 / 831712 | AraportID: | AT5G03000 | Length: | 354 | Species: | Arabidopsis thaliana |
Alignment Length: | 219 | Identity: | 49/219 - (22%) |
---|---|---|---|
Similarity: | 88/219 - (40%) | Gaps: | 43/219 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 418 VKKKWNEI--AP-MHCRRCYVSVTELNGMIYAIGGYDGHNRLNTVERYNPRTNQWSVIPPMNMQR 479
Fly 480 --------------SDASACTLQERIYATGGFNGQECLDSAEYYDPVTNVWTRIPNMNHRRSGVS 530
Fly 531 CVAFRNQLYVIGGFNGTARLSTGERFDPDTQTWHFI----REMNHSRSNFGLEIIDDMIFAIGG- 590
Fly 591 ---FNGVSTISHTECYVAETDEWM 611 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
klhl10 | NP_001015100.2 | BTB | 72..186 | CDD:279045 | |
PHA03098 | 86..610 | CDD:222983 | 48/216 (22%) | ||
BACK | 195..298 | CDD:285009 | |||
Kelch | 347..394 | CDD:128874 | |||
KELCH repeat | 385..428 | CDD:276965 | 3/12 (25%) | ||
Kelch | 396..442 | CDD:128874 | 7/26 (27%) | ||
Kelch_1 | 431..476 | CDD:279660 | 12/44 (27%) | ||
KELCH repeat | 432..475 | CDD:276965 | 11/42 (26%) | ||
KELCH repeat | 479..523 | CDD:276965 | 9/57 (16%) | ||
Kelch | 490..536 | CDD:128874 | 11/45 (24%) | ||
Kelch_1 | 525..570 | CDD:279660 | 15/48 (31%) | ||
KELCH repeat | 526..571 | CDD:276965 | 15/48 (31%) | ||
Kelch_1 | 573..617 | CDD:279660 | 9/43 (21%) | ||
KELCH repeat | 573..617 | CDD:276965 | 9/43 (21%) | ||
AT5G03000 | NP_195920.1 | F-box | 40..85 | CDD:279040 | 4/18 (22%) |
KELCH repeat | 138..175 | CDD:276965 | 8/36 (22%) | ||
Kelch | 144..189 | CDD:128874 | 11/44 (25%) | ||
Kelch_1 | 178..219 | CDD:279660 | 14/40 (35%) | ||
KELCH repeat | 179..227 | CDD:276965 | 15/47 (32%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1072 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 1 | 1.000 | - | - | X9 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |