DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment klhl10 and AT5G03010

DIOPT Version :10

Sequence 1:NP_001015100.2 Gene:klhl10 / 3354863 FlyBaseID:FBgn0040038 Length:767 Species:Drosophila melanogaster
Sequence 2:NP_195921.2 Gene:AT5G03010 / 831473 AraportID:AT5G03010 Length:232 Species:Arabidopsis thaliana


Alignment Length:114 Identity:28/114 - (24%)
Similarity:40/114 - (35%) Gaps:20/114 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   449 GYDGHNRLNTVERYNPRTNQWSVIPPMNMQRSDASACTLQERIYATGGFNGQECLDSAEYYDPVT 513
            |:....|...|...:.|:.||..:|.|...|:..:|......|...||...:......|.||..|
plant     7 GFVRRRRSRRVLVLDCRSQQWRSLPKMRQPRASPAAYVKDGLIIVIGGCRSKNIETWGEIYDLKT 71

  Fly   514 NVWTRIPNMNHRRSGVSCVAFRNQLYVIGGFNGTARLSTGERFDPDTQT 562
            |.|.||...:|                    :.|.:.:...||.|:.||
plant    72 NTWGRILLQSH--------------------DPTVQNAYLNRFKPNLQT 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
klhl10NP_001015100.2 BTB_POZ 62..>108 CDD:453885
PHA03098 86..610 CDD:222983 28/114 (25%)
KELCH repeat 385..428 CDD:276965
KELCH repeat 432..475 CDD:276965 7/25 (28%)
KELCH repeat 479..523 CDD:276965 13/43 (30%)
KELCH repeat 526..571 CDD:276965 6/37 (16%)
KELCH repeat 573..617 CDD:276965
AT5G03010NP_195921.2 NanM <24..>74 CDD:442289 14/49 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.