DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment klhl10 and AT5G01660

DIOPT Version :9

Sequence 1:NP_001015100.2 Gene:klhl10 / 3354863 FlyBaseID:FBgn0040038 Length:767 Species:Drosophila melanogaster
Sequence 2:NP_001331423.1 Gene:AT5G01660 / 830423 AraportID:AT5G01660 Length:656 Species:Arabidopsis thaliana


Alignment Length:387 Identity:108/387 - (27%)
Similarity:159/387 - (41%) Gaps:82/387 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   276 VAHLMTGVR----LGL--MTPKCFMEEV--KEHPYVLE----CEAAK----PLIVDTFKFMYDLD 324
            ::.||..|:    .||  .|..|::||.  |.|..:.:    |...:    |||  |.....||:
plant   296 ISQLMHEVKELRACGLENSTKICYLEEKLDKAHKEIYQLTERCNMLESISGPLI--TKAGGSDLE 358

  Fly   325 FLNPQADELTTPPLAMPRLPHEVIFAIGGWSGGTSKGCIETYDTRADRWVTINAEDPAGPRAYHG 389
            ..:|....|.         |.|.|..:||            :|..::.|::              
plant   359 IHSPDDTSLD---------PTEAILLLGG------------FDKDSETWLS-------------- 388

  Fly   390 TAVLGFKIFSIGGYDGVEYFNTCRVFDAVKKKWNEIAPMHCRRCYVSVTELNGMIYAIGGYD-GH 453
                     |:     ..||.:..|..|       .:.|.|.|...||.:|:|.||..||.| |.
plant   389 ---------SV-----QSYFPSRNVVKA-------HSSMSCIRSNASVAKLDGKIYVFGGDDGGR 432

  Fly   454 NRLNTVERYNPRTNQWSVIPPMNMQRSDASACTLQERIYATGGFNGQECLDSAEYYDPVTNVWTR 518
            ...|:.|.:|....|||:.||:|.::......||..:|:|.||.||.......|..||....|.|
plant   433 GWTNSAESFNQTDGQWSLCPPLNERKGSLGGATLDGKIFAIGGGNGMVSFSDVEMLDPDIGRWIR 497

  Fly   519 IPNMNHRRSGVSCVAFRNQLYVIGGFNGTARLSTGERFDPDTQTWHFIREMNHSRSNFGLEIIDD 583
            ..:|...|..|:.|..::.:|.:||::|...|:|.|||||...:|..|..|...|....|.::::
plant   498 TRSMGQERFAVASVEHKSSIYAVGGYDGKEYLNTAERFDPREHSWMNIASMKSRRGCHSLVVLNE 562

  Fly   584 MIFAIGGFNGVSTISHTECYVAETDEWMEATDMNIVR--SAL-----SANNIAGLPNKRDYI 638
            .::|||||:|.:.:|..|.|...|..||....|..:|  ||:     |...|.|...:.|.|
plant   563 KLYAIGGFDGETMVSSVEIYEPRTGTWMTGEPMKDLRGYSAVAVVKDSIYVIGGYKGEEDDI 624

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
klhl10NP_001015100.2 BTB 72..186 CDD:279045
PHA03098 86..610 CDD:222983 97/350 (28%)
BACK 195..298 CDD:285009 9/29 (31%)
Kelch 347..394 CDD:128874 5/46 (11%)
KELCH repeat 385..428 CDD:276965 5/42 (12%)
Kelch 396..442 CDD:128874 11/45 (24%)
Kelch_1 431..476 CDD:279660 19/45 (42%)
KELCH repeat 432..475 CDD:276965 18/43 (42%)
KELCH repeat 479..523 CDD:276965 13/43 (30%)
Kelch 490..536 CDD:128874 15/45 (33%)
Kelch_1 525..570 CDD:279660 16/44 (36%)
KELCH repeat 526..571 CDD:276965 17/44 (39%)
Kelch_1 573..617 CDD:279660 14/43 (33%)
KELCH repeat 573..617 CDD:276965 14/43 (33%)
AT5G01660NP_001331423.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1072
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2846
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.