DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment klhl10 and AT4G39756

DIOPT Version :9

Sequence 1:NP_001015100.2 Gene:klhl10 / 3354863 FlyBaseID:FBgn0040038 Length:767 Species:Drosophila melanogaster
Sequence 2:NP_568071.1 Gene:AT4G39756 / 830133 AraportID:AT4G39756 Length:374 Species:Arabidopsis thaliana


Alignment Length:214 Identity:48/214 - (22%)
Similarity:82/214 - (38%) Gaps:41/214 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   416 DAVKKKWN-------EIAPMHCRRCYVSVTELNGMIYAIGGYDGHNRLNTVERYNPRTN--QWSV 471
            |..|||.:       .|...:..|..:.:.|:...:|||   ..||..::|.....:|:  .|..
plant   101 DIGKKKKSTRNTLLVPIPSSYSPRVPMFIGEIGSELYAI---SKHNTPSSVMWVRDKTSIYAWRK 162

  Fly   472 IPPMNMQRSDASACTLQERIYATGGFNGQECLDSAEYYDPVTNVWTRI--PNMNHRRSGVSCVAF 534
            .|.|.:.|::..|..:..:||..||....|....||.:||.|..|..:  |....|.|.:..:|.
plant   163 APSMTVARANVFAYVINGKIYVMGGCAADESKYWAEVFDPKTQTWKPLTDPGAELRVSSIIGMAV 227

  Fly   535 -RNQLYVIGGFNGTARLSTGERFDPDTQTWHFIREMNHSRSNFGLE---IIDDMIFAIGGFNGVS 595
             ..::||...:      .....:||:...|..:      .|:|.:|   .|:::::         
plant   228 SEGKIYVKNSY------VKDYVYDPEEDKWDVV------ASSFMIERKCEIENVLY--------- 271

  Fly   596 TISHTEC--YVAETDEWME 612
            ..|...|  |..:..||.:
plant   272 RFSRQSCSWYDTKHKEWRD 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
klhl10NP_001015100.2 BTB 72..186 CDD:279045
PHA03098 86..610 CDD:222983 46/210 (22%)
BACK 195..298 CDD:285009
Kelch 347..394 CDD:128874
KELCH repeat 385..428 CDD:276965 5/18 (28%)
Kelch 396..442 CDD:128874 7/32 (22%)
Kelch_1 431..476 CDD:279660 11/46 (24%)
KELCH repeat 432..475 CDD:276965 11/44 (25%)
KELCH repeat 479..523 CDD:276965 14/45 (31%)
Kelch 490..536 CDD:128874 15/48 (31%)
Kelch_1 525..570 CDD:279660 8/45 (18%)
KELCH repeat 526..571 CDD:276965 7/45 (16%)
Kelch_1 573..617 CDD:279660 9/45 (20%)
KELCH repeat 573..617 CDD:276965 9/45 (20%)
AT4G39756NP_568071.1 F-box 18..65 CDD:279040
Kelch_1 169..214 CDD:279660 13/44 (30%)
KELCH repeat 170..215 CDD:276965 14/44 (32%)
KELCH repeat 218..256 CDD:276965 8/49 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1072
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X9
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.