DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment klhl10 and AT4G39753

DIOPT Version :10

Sequence 1:NP_001015100.2 Gene:klhl10 / 3354863 FlyBaseID:FBgn0040038 Length:767 Species:Drosophila melanogaster
Sequence 2:NP_568070.1 Gene:AT4G39753 / 830132 AraportID:AT4G39753 Length:390 Species:Arabidopsis thaliana


Alignment Length:144 Identity:40/144 - (27%)
Similarity:56/144 - (38%) Gaps:24/144 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   503 LDSAEY-----YDP-----VTN----VWTRIPNMNHRRSGVSCVAFRNQLYVIGGFNGTARLSTG 553
            :||..|     |.|     |.|    :|...|:|...|:......|..::||:||...|...:.|
plant   145 IDSDVYAFKQCYPPSRVMFVRNKECVIWRNAPDMTVARANPVAYVFDRKIYVMGGCAETESANWG 209

  Fly   554 ERFDPDTQTWHFI----REMNHSRSNFGLEIIDDMIFAIGGFNGVSTISHTECYVAETDEWMEAT 614
            |.|||.||||..:    .|:..|.....:|:|.      |.|...|..|....|....::|..|.
plant   210 EVFDPKTQTWEPLPVPSPELRFSSMIRKIEMIQ------GKFYVRSNDSKDSVYDPIREKWNVAA 268

  Fly   615 DMNIVRSALSANNI 628
            ...:..|..|..|:
plant   269 KPQLNDSRCSVGNV 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
klhl10NP_001015100.2 BTB_POZ 62..>108 CDD:453885
PHA03098 86..610 CDD:222983 35/124 (28%)
KELCH repeat 385..428 CDD:276965
KELCH repeat 432..475 CDD:276965
KELCH repeat 479..523 CDD:276965 9/33 (27%)
KELCH repeat 526..571 CDD:276965 17/48 (35%)
KELCH repeat 573..617 CDD:276965 9/43 (21%)
AT4G39753NP_568070.1 F-box_SF 40..78 CDD:459239
NanM 172..>268 CDD:442289 29/101 (29%)
KELCH repeat 182..227 CDD:276965 16/44 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.