DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment klhl10 and AT4G39600

DIOPT Version :9

Sequence 1:NP_001015100.2 Gene:klhl10 / 3354863 FlyBaseID:FBgn0040038 Length:767 Species:Drosophila melanogaster
Sequence 2:NP_001328959.1 Gene:AT4G39600 / 830114 AraportID:AT4G39600 Length:378 Species:Arabidopsis thaliana


Alignment Length:175 Identity:34/175 - (19%)
Similarity:55/175 - (31%) Gaps:55/175 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   461 RYNPRTN-QWSVI-----------------------------PPMNMQRSDASACTLQERIYATG 495
            ||:|..| :|..:                             ||:..    :|...:...:||..
plant    83 RYSPEDNPRWFTLCRKPNRRTLSKEKNESSGNLLVPIPIINSPPLEW----SSIVAVGSHLYAIN 143

  Fly   496 GFNGQECLDSAEYYDPVTNVWTRIPNMN--HRRSGVSCVAFRNQLYVIGGFNGTARLSTGERFDP 558
            |........:..:.|..::.|...|:|.  |..|.:.     .::|:.|.......|:..:.|..
plant   144 GPIEDAPCSNVSFLDCRSHTWLEAPSMRVAHTNSQLD-----GKMYLAGSSENVDSLNCIQVFST 203

  Fly   559 DTQTWHFIREMNHSRSNFGLEIIDDMIFAIGGFNG-VSTISHTEC 602
            .||||..:.             ....||.:|...| :.||..|||
plant   204 KTQTWKPVP-------------FQKRIFGVGDLEGKIYTICRTEC 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
klhl10NP_001015100.2 BTB 72..186 CDD:279045
PHA03098 86..610 CDD:222983 34/175 (19%)
BACK 195..298 CDD:285009
Kelch 347..394 CDD:128874
KELCH repeat 385..428 CDD:276965
Kelch 396..442 CDD:128874
Kelch_1 431..476 CDD:279660 7/44 (16%)
KELCH repeat 432..475 CDD:276965 6/43 (14%)
KELCH repeat 479..523 CDD:276965 7/43 (16%)
Kelch 490..536 CDD:128874 9/47 (19%)
Kelch_1 525..570 CDD:279660 9/44 (20%)
KELCH repeat 526..571 CDD:276965 9/44 (20%)
Kelch_1 573..617 CDD:279660 9/31 (29%)
KELCH repeat 573..617 CDD:276965 9/31 (29%)
AT4G39600NP_001328959.1 F-box 27..70 CDD:366220
PHA03098 <116..230 CDD:222983 24/135 (18%)
KELCH repeat 131..170 CDD:276965 7/38 (18%)
Kelch_1 170..212 CDD:366584 11/46 (24%)
KELCH repeat 171..213 CDD:276965 10/59 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1072
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X9
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.