DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment klhl10 and AT4G39580

DIOPT Version :9

Sequence 1:NP_001015100.2 Gene:klhl10 / 3354863 FlyBaseID:FBgn0040038 Length:767 Species:Drosophila melanogaster
Sequence 2:NP_195668.1 Gene:AT4G39580 / 830112 AraportID:AT4G39580 Length:375 Species:Arabidopsis thaliana


Alignment Length:162 Identity:42/162 - (25%)
Similarity:68/162 - (41%) Gaps:11/162 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   382 AGPRAYHGTAVLGFKIFSIGGYDGVEYFNTCRVFDAVKKKWNEIAPMHCRRCYVSVTELNGMIYA 446
            |.|..:.....:.:.|::|||.......::..|.|...:||.|...|...|.|.:.|.|:|.||.
plant   118 APPAHWSSVVAVDYNIYAIGGPINDAPSSSVSVLDCQCEKWREAPSMRVARNYPTATVLDGKIYV 182

  Fly   447 IGGYDGHNRLNTVERYNPRTNQWSVIPPMNMQRSDASACTLQERIYATGGFNGQECLDSAE---Y 508
            .||.:....|:.:|.::|:|..|..:.....:|     |  :..:|.:.|..|:..|....   .
plant   183 AGGCEDCTSLDCIEVFDPKTQTWDSVASPGTER-----C--ERLVYKSVGIEGKYHLFGGAGHVA 240

  Fly   509 YDPVTNVWTRI-PNMNHRRSGVSCVAFRNQLY 539
            |||....|..: .:|...|:.||.....|.|:
plant   241 YDPKEGRWDSVGMDMEMGRTWVSYCVINNILF 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
klhl10NP_001015100.2 BTB 72..186 CDD:279045
PHA03098 86..610 CDD:222983 42/162 (26%)
BACK 195..298 CDD:285009
Kelch 347..394 CDD:128874 2/11 (18%)
KELCH repeat 385..428 CDD:276965 9/42 (21%)
Kelch 396..442 CDD:128874 14/45 (31%)
Kelch_1 431..476 CDD:279660 14/44 (32%)
KELCH repeat 432..475 CDD:276965 14/42 (33%)
KELCH repeat 479..523 CDD:276965 10/47 (21%)
Kelch 490..536 CDD:128874 12/49 (24%)
Kelch_1 525..570 CDD:279660 5/15 (33%)
KELCH repeat 526..571 CDD:276965 5/14 (36%)
Kelch_1 573..617 CDD:279660
KELCH repeat 573..617 CDD:276965
AT4G39580NP_195668.1 F-box 26..65 CDD:395521
PHA03098 <125..300 CDD:222983 40/155 (26%)
KELCH repeat 125..164 CDD:276965 9/38 (24%)
KELCH repeat 168..212 CDD:276965 14/43 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1072
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X9
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.