DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment klhl10 and AT4G39060

DIOPT Version :10

Sequence 1:NP_001015100.2 Gene:klhl10 / 3354863 FlyBaseID:FBgn0040038 Length:767 Species:Drosophila melanogaster
Sequence 2:NP_195617.4 Gene:AT4G39060 / 830061 AraportID:AT4G39060 Length:368 Species:Arabidopsis thaliana


Alignment Length:141 Identity:33/141 - (23%)
Similarity:54/141 - (38%) Gaps:32/141 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   405 GVEYFNTCRVFDAVKKKWNEIAPMHCRRCYVSVTELNGMIYAIGGYDGHNRLNTVERYNPRTNQW 469
            ||:|.||.|          ::........:|.:|        .|||    ....:..|..||.|.
plant     9 GVQYRNTGR----------DVKASSTASVFVFIT--------TGGY----CFEQLGSYRYRTTQS 51

  Fly   470 SVIPPMNMQRSDA--SACTLQERIYATGGFNGQECLDSAEYYDPVTNVWTRIP-NMNHRRSGVSC 531
            |::.|    |:.|  |:.|...|..|  .|..::.:..:.|..| |||...:| :.......:.|
plant    52 SLLSP----RASARWSSQTYSMRYEA--NFKLKKNVFISAYNRP-TNVVPSVPSSYTPFPPNLIC 109

  Fly   532 VAFRNQLYVIG 542
            ....:::|.:|
plant   110 AEVGSEIYTVG 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
klhl10NP_001015100.2 BTB_POZ 62..>108 CDD:453885
PHA03098 86..610 CDD:222983 33/141 (23%)
KELCH repeat 385..428 CDD:276965 6/22 (27%)
KELCH repeat 432..475 CDD:276965 10/42 (24%)
KELCH repeat 479..523 CDD:276965 13/46 (28%)
KELCH repeat 526..571 CDD:276965 3/17 (18%)
KELCH repeat 573..617 CDD:276965
AT4G39060NP_195617.4 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.