DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment klhl10 and AT4G23580

DIOPT Version :10

Sequence 1:NP_001015100.2 Gene:klhl10 / 3354863 FlyBaseID:FBgn0040038 Length:767 Species:Drosophila melanogaster
Sequence 2:NP_194089.1 Gene:AT4G23580 / 828458 AraportID:AT4G23580 Length:383 Species:Arabidopsis thaliana


Alignment Length:169 Identity:45/169 - (26%)
Similarity:67/169 - (39%) Gaps:45/169 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   389 GTAVLGFKIFSIGGYDGVEYFNTCRVFDAVKKKWNEIAPMHCRRCYVSVTELNGMIYAIGGYDGH 453
            |..|:|..:::|||              ..|.|                   |..|||.|. ..:
plant   113 GVVVVGPDVYAIGG--------------GSKNK-------------------NVSIYATGS-KTY 143

  Fly   454 NRLNTVERYNPRTNQWSVIPPMNMQRSDASACTLQERIYATGGFNGQECLDSAEYYDPVTNVW-- 516
            |.|::|...|.|::.|...|.|.:.|...|||||..|||.|||.:..:.::..|.:|..|..|  
plant   144 NALSSVMIMNSRSHTWHEAPSMRVGRVFPSACTLDGRIYVTGGCDNLDTMNWMEIFDTKTQTWEF 208

  Fly   517 TRIPNMNHRRSGVSCVAFRNQLYVIGGFNGTARLSTGER 555
            .:||      |...|   :...|:...:.||..:.:.|:
plant   209 LQIP------SEEIC---KGSEYLSVSYQGTVYVKSDEK 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
klhl10NP_001015100.2 BTB_POZ 62..>108 CDD:453885
PHA03098 86..610 CDD:222983 45/169 (27%)
KELCH repeat 385..428 CDD:276965 8/38 (21%)
KELCH repeat 432..475 CDD:276965 12/42 (29%)
KELCH repeat 479..523 CDD:276965 18/45 (40%)
KELCH repeat 526..571 CDD:276965 6/30 (20%)
KELCH repeat 573..617 CDD:276965
AT4G23580NP_194089.1 F-box_AtAFR-like 15..59 CDD:438923
PHA03098 <122..299 CDD:222983 42/160 (26%)
NanM <122..>207 CDD:442289 33/118 (28%)
KELCH repeat 169..209 CDD:276965 16/39 (41%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.