DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment klhl10 and AT4G11770

DIOPT Version :9

Sequence 1:NP_001015100.2 Gene:klhl10 / 3354863 FlyBaseID:FBgn0040038 Length:767 Species:Drosophila melanogaster
Sequence 2:NP_192914.1 Gene:AT4G11770 / 826783 AraportID:AT4G11770 Length:396 Species:Arabidopsis thaliana


Alignment Length:195 Identity:48/195 - (24%)
Similarity:81/195 - (41%) Gaps:49/195 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   393 LGFKIFSIGGY-DGVEYFNTCRVF--DAVKKKWNEIAPMHCRRCYVSVTELNGMIYAIGGYDGHN 454
            :|..|:.|||| :||   .:.|||  |.....|:|...|...|....|..|:|.||.:.|:.|.:
plant   148 IGSYIYMIGGYINGV---LSSRVFFLDCRSHTWHEAPSMQVARKSPLVNVLDGKIYVVEGWRGSD 209

  Fly   455 RLNTVERYNPRTNQWSVIPPMNMQ---RSDASACTLQERIYATG----------------GFN-- 498
            ..|.:|.::|:|.:|..:|..:.:   |..:.....:|::|..|                ||:  
plant   210 YSNLIEIFDPKTQKWEHVPSPSAEMRGRYISKGLVYEEKLYLFGDKNVVYKPKESRWDALGFDMN 274

  Fly   499 ------GQEC-LDSAEY---------YDPVTNVW------TRIPNMNHRRSGVSCVAFRNQLYVI 541
                  |..| :|:..|         ||.....|      .::|.:.||||.:..|.:..::.::
plant   275 LWLVSYGSSCVIDNVCYMVFYKRLIWYDSEVRYWRVLKGLEKLPKLRHRRSCIRMVDYGGKIAIL 339

  Fly   542  541
            plant   340  339

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
klhl10NP_001015100.2 BTB 72..186 CDD:279045
PHA03098 86..610 CDD:222983 48/195 (25%)
BACK 195..298 CDD:285009