DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment klhl10 and AT4G11750

DIOPT Version :9

Sequence 1:NP_001015100.2 Gene:klhl10 / 3354863 FlyBaseID:FBgn0040038 Length:767 Species:Drosophila melanogaster
Sequence 2:NP_192912.2 Gene:AT4G11750 / 826781 AraportID:AT4G11750 Length:386 Species:Arabidopsis thaliana


Alignment Length:199 Identity:47/199 - (23%)
Similarity:75/199 - (37%) Gaps:45/199 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   385 RAYHGTAVLGFKIFSIGGYDGVEYFNTCRV--------FDAVKKKWNEIAPMHCRRCYVSVTELN 441
            |..:|:.:...::|:.|.:.....|..||.        .|..|||     |...|       .|:
plant   133 RITNGSNIYIVRVFTNGAFSSRFLFMDCRSHTLHEVPRMDKTKKK-----PFMIR-------VLD 185

  Fly   442 GMIYAIGGYDGHNRLNTVERYNPRTNQWSVIPPMNMQRSDASACTLQERIYATGG--FNGQECL- 503
            |.||.|.|....:..|.:||::.:|..|..:|..:.:...:         |.||.  ::|:..| 
plant   186 GKIYVIEGCKNPDYSNLIERFDLKTQTWEHVPSPSAEIRGS---------YITGSLVYDGKLYLF 241

  Fly   504 -DSAEYYDPVTNVW----TRIPNMNHRRSGVSCVAFRNQLYVIGGFNGTARLSTGERFDPDTQTW 563
             |....|.|..|.|    ..:| :....|.:|||. .|.:|..|........:|.||.      |
plant   242 GDKRVVYKPKENKWDVVGLEMP-LRWTPSYISCVV-DNVIYSYGRSRVLMWYNTEERL------W 298

  Fly   564 HFIR 567
            .:::
plant   299 RYLK 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
klhl10NP_001015100.2 BTB 72..186 CDD:279045
PHA03098 86..610 CDD:222983 47/199 (24%)
BACK 195..298 CDD:285009
Kelch 347..394 CDD:128874 2/8 (25%)
KELCH repeat 385..428 CDD:276965 11/50 (22%)
Kelch 396..442 CDD:128874 12/53 (23%)
Kelch_1 431..476 CDD:279660 13/44 (30%)
KELCH repeat 432..475 CDD:276965 12/42 (29%)
KELCH repeat 479..523 CDD:276965 11/51 (22%)
Kelch 490..536 CDD:128874 15/53 (28%)
Kelch_1 525..570 CDD:279660 11/43 (26%)
KELCH repeat 526..571 CDD:276965 11/42 (26%)
Kelch_1 573..617 CDD:279660
KELCH repeat 573..617 CDD:276965
AT4G11750NP_192912.2 F-box 11..51 CDD:279040
Kelch_1 183..220 CDD:279660 12/36 (33%)
KELCH repeat 224..263 CDD:276965 10/47 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1072
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X9
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.