Sequence 1: | NP_001015100.2 | Gene: | klhl10 / 3354863 | FlyBaseID: | FBgn0040038 | Length: | 767 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_192912.2 | Gene: | AT4G11750 / 826781 | AraportID: | AT4G11750 | Length: | 386 | Species: | Arabidopsis thaliana |
Alignment Length: | 199 | Identity: | 47/199 - (23%) |
---|---|---|---|
Similarity: | 75/199 - (37%) | Gaps: | 45/199 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 385 RAYHGTAVLGFKIFSIGGYDGVEYFNTCRV--------FDAVKKKWNEIAPMHCRRCYVSVTELN 441
Fly 442 GMIYAIGGYDGHNRLNTVERYNPRTNQWSVIPPMNMQRSDASACTLQERIYATGG--FNGQECL- 503
Fly 504 -DSAEYYDPVTNVW----TRIPNMNHRRSGVSCVAFRNQLYVIGGFNGTARLSTGERFDPDTQTW 563
Fly 564 HFIR 567 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
klhl10 | NP_001015100.2 | BTB | 72..186 | CDD:279045 | |
PHA03098 | 86..610 | CDD:222983 | 47/199 (24%) | ||
BACK | 195..298 | CDD:285009 | |||
Kelch | 347..394 | CDD:128874 | 2/8 (25%) | ||
KELCH repeat | 385..428 | CDD:276965 | 11/50 (22%) | ||
Kelch | 396..442 | CDD:128874 | 12/53 (23%) | ||
Kelch_1 | 431..476 | CDD:279660 | 13/44 (30%) | ||
KELCH repeat | 432..475 | CDD:276965 | 12/42 (29%) | ||
KELCH repeat | 479..523 | CDD:276965 | 11/51 (22%) | ||
Kelch | 490..536 | CDD:128874 | 15/53 (28%) | ||
Kelch_1 | 525..570 | CDD:279660 | 11/43 (26%) | ||
KELCH repeat | 526..571 | CDD:276965 | 11/42 (26%) | ||
Kelch_1 | 573..617 | CDD:279660 | |||
KELCH repeat | 573..617 | CDD:276965 | |||
AT4G11750 | NP_192912.2 | F-box | 11..51 | CDD:279040 | |
Kelch_1 | 183..220 | CDD:279660 | 12/36 (33%) | ||
KELCH repeat | 224..263 | CDD:276965 | 10/47 (21%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1072 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 1 | 1.000 | - | - | X9 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |