DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment klhl10 and AT3G43710

DIOPT Version :9

Sequence 1:NP_001015100.2 Gene:klhl10 / 3354863 FlyBaseID:FBgn0040038 Length:767 Species:Drosophila melanogaster
Sequence 2:NP_189957.1 Gene:AT3G43710 / 823479 AraportID:AT3G43710 Length:378 Species:Arabidopsis thaliana


Alignment Length:227 Identity:48/227 - (21%)
Similarity:84/227 - (37%) Gaps:45/227 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   337 PLAMPR-LPHEV-----IFAIGGWSGGTSKGCIETYDTRADRWVTINAEDPAGPRAYHGTAVLGF 395
            |.::|: ||..|     |:.|||.....:...:...|.|:..|  ..|:.....|......||..
plant   114 PDSIPKFLPDVVLVGSNIYVIGGLINNNASHKVMVMDCRSHTW--REAQGTCVARVSPSACVLDG 176

  Fly   396 KIFSIGGYDGVEYFNTCRVFDAVKKKWNEIAPMH---CRRCYVSVTELNGMIYAIGGYDGHNRLN 457
            ||:..||...::......|||...:.|..::...   ||    .:|....:     ||||:..:.
plant   177 KIYVAGGCKNLDATMWMEVFDTKTESWEFVSSPGEEICR----DLTSCESI-----GYDGNVYVE 232

  Fly   458 TVERYNP--------RTNQWSVIPPMNMQRSDASACTLQERIYATGGFNGQECLDSAEYYDPVTN 514
            :::.|..        |..|:|    |:...|.:|.|.:...:|.:..:       ..|:||....
plant   233 SMKTYGLYELHKGRWREGQYS----MSRGGSLSSQCVIDNVLYRSWSY-------MVEWYDSENK 286

  Fly   515 VWTRIPNM------NHRRSGVSCVAFRNQLYV 540
            :|..:..:      .::.....||.:..:|.|
plant   287 LWNSLKGLEKLFIVTNQYVPTKCVNYGGKLAV 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
klhl10NP_001015100.2 BTB 72..186 CDD:279045
PHA03098 86..610 CDD:222983 48/227 (21%)
BACK 195..298 CDD:285009
Kelch 347..394 CDD:128874 11/51 (22%)
KELCH repeat 385..428 CDD:276965 11/42 (26%)
Kelch 396..442 CDD:128874 11/48 (23%)
Kelch_1 431..476 CDD:279660 10/52 (19%)
KELCH repeat 432..475 CDD:276965 9/50 (18%)
KELCH repeat 479..523 CDD:276965 8/49 (16%)
Kelch 490..536 CDD:128874 7/51 (14%)
Kelch_1 525..570 CDD:279660 4/16 (25%)
KELCH repeat 526..571 CDD:276965 4/15 (27%)
Kelch_1 573..617 CDD:279660
KELCH repeat 573..617 CDD:276965
AT3G43710NP_189957.1 F-box 24..69 CDD:279040
KELCH repeat 124..162 CDD:276965 9/39 (23%)
Kelch_1 124..159 CDD:279660 8/36 (22%)
Kelch_1 165..210 CDD:279660 11/44 (25%)
KELCH repeat 166..212 CDD:276965 11/45 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1072
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X9
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.