DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment klhl10 and AT3G27910

DIOPT Version :10

Sequence 1:NP_001015100.2 Gene:klhl10 / 3354863 FlyBaseID:FBgn0040038 Length:767 Species:Drosophila melanogaster
Sequence 2:NP_189429.1 Gene:AT3G27910 / 822414 AraportID:AT3G27910 Length:294 Species:Arabidopsis thaliana


Alignment Length:201 Identity:49/201 - (24%)
Similarity:80/201 - (39%) Gaps:22/201 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   393 LGFKIFSIGGYDGVEYFNTCRVFDAVKKKWNEIAPMHCRRCYVSVTELNGMIYAIGGYDGHNRL- 456
            ||.||:..||....:..:...|.|.:...:..:..|...|...:...::|.||.||||:..:.| 
plant    45 LGHKIYVFGGCINGDMTSNVFVIDCLHGTFQFLPSMRVPRGCAAFGIVDGKIYVIGGYNKADSLD 109

  Fly   457 NTVERYNPRTNQWSVIPPM---NMQRSDASACTLQERIYATGGFNGQECLDSAEYYDPVTNVWTR 518
            |.||.::.....|.....:   .:.:....:..:.::||.....||       ..:||...||.|
plant   110 NWVEVFDLEKQTWESFSGLCNEELSKITLKSVVMNKKIYIMDRGNG-------IVFDPKKGVWER 167

  Fly   519 IPNMNHRRSGVSCVAFRNQLYVIGGFNGTARLSTGERFDPDTQTWHFIREMNHSRSNFGLEIIDD 583
            ...::......||| ..|.||.. ||:...|:.....:||..:.|.|::         |:|.|..
plant   168 DFLLDRDWVVGSCV-IDNMLYTF-GFDSVKRIYRVRVYDPSVRVWSFVK---------GIEDIPK 221

  Fly   584 MIFAIG 589
            |...:|
plant   222 MDGTLG 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
klhl10NP_001015100.2 BTB_POZ 62..>108 CDD:453885
PHA03098 86..610 CDD:222983 49/201 (24%)
KELCH repeat 385..428 CDD:276965 8/34 (24%)
KELCH repeat 432..475 CDD:276965 13/43 (30%)
KELCH repeat 479..523 CDD:276965 9/43 (21%)
KELCH repeat 526..571 CDD:276965 13/44 (30%)
KELCH repeat 573..617 CDD:276965 5/17 (29%)
AT3G27910NP_189429.1 NanM 48..>190 CDD:442289 35/150 (23%)
KELCH repeat 84..130 CDD:276965 13/45 (29%)
KELCH repeat 173..213 CDD:276965 12/41 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.