DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment klhl10 and AT2G44030

DIOPT Version :9

Sequence 1:	NP_001015100.2	Gene:	klhl10 / 3354863	FlyBaseID:	FBgn0040038	Length:	767	Species:	Drosophila melanogaster
Sequence 2:	NP_181931.1	Gene:	AT2G44030 / 819008	AraportID:	AT2G44030	Length:	380	Species:	Arabidopsis thaliana

Alignment Length:	129	Identity:	31/129 - (24%)
Similarity:	56/129 - (43%)	Gaps:	8/129 - (6%)

- Green bases have known domain annotations that are detailed below.

  Fly   436 SVTELNGMIYAIGGYDG-HNRLNTVERYNPRTNQWSVIPPMNMQRSDASACTLQERIYATGGFNG 499
            :|......||.:||:.. ..|.......:.:::||..:|.|.:.|.:|:|..:..:|...||.:.
plant   116 TVVSTGSEIYLLGGFVAKEKRSRRAYVLDCKSHQWRRLPKMRIARKEAAANVIDGKINVYGGCSS 180

  Fly   500 Q--ECLDSAEYYDPVTNVWTRIPNMNHRRSGV-SCVAFRNQLYVIGGFNGTARLSTGERFDPDT 560
            :  ..::..|.|||:|..|...|.....:.|| .|...::.:    .|.....|.:|:.:|..|
plant   181 EYHNSVNWGEIYDPMTQTWEPFPEGALNKEGVIPCALIKDGI----AFPDCGLLISGKVYDTTT 240

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
klhl10	NP_001015100.2	BTB	72..186	CDD:279045
		PHA03098	86..610	CDD:222983	31/129 (24%)
		BACK	195..298	CDD:285009
		Kelch	347..394	CDD:128874
		KELCH repeat	385..428	CDD:276965
		Kelch	396..442	CDD:128874	1/5 (20%)
		Kelch_1	431..476	CDD:279660	9/40 (23%)
		KELCH repeat	432..475	CDD:276965	9/39 (23%)
		KELCH repeat	479..523	CDD:276965	13/45 (29%)
		Kelch	490..536	CDD:128874	13/48 (27%)
		Kelch_1	525..570	CDD:279660	8/37 (22%)
		KELCH repeat	526..571	CDD:276965	8/36 (22%)
		Kelch_1	573..617	CDD:279660
		KELCH repeat	573..617	CDD:276965
AT2G44030	NP_181931.1	F-box	19..64	CDD:279040
		KELCH repeat	112..157	CDD:276965	9/40 (23%)
		Kelch_6	115..160	CDD:290672	10/43 (23%)
		Kelch_1	159..204	CDD:279660	12/44 (27%)
		KELCH repeat	160..204	CDD:276965	12/43 (28%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG1072
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	1.810