DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment klhl10 and AT2G29860

DIOPT Version :9

Sequence 1:NP_001015100.2 Gene:klhl10 / 3354863 FlyBaseID:FBgn0040038 Length:767 Species:Drosophila melanogaster
Sequence 2:NP_180547.1 Gene:AT2G29860 / 817536 AraportID:AT2G29860 Length:240 Species:Arabidopsis thaliana


Alignment Length:172 Identity:44/172 - (25%)
Similarity:71/172 - (41%) Gaps:31/172 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   393 LGFKIFSIGGYDGVEYFNTCRVFDAVKKKWNEIAPMHCRRCY--------VSVTELNGMIYAIGG 449
            ||||...:..:.|...:.|.|.|  :.::.|  .|:..||..        .:|..:...||.:||
plant    66 LGFKEPVLYAFIGCTPYTTPRWF--ILRRSN--IPLQLRRLNSLPHMFPGAAVVTIGYKIYVMGG 126

  Fly   450 YDGHNRLNTVERYNPRTNQWSVIPPMNMQRSDASACTLQERIYATGGFNGQECLDSAEYYDPVTN 514
            |: :..::||...:.|.:.|..:..|...|..|:...:..|||..||...|:. |..|.:|..|.
plant   127 YN-YQPVSTVIIIDCRFHTWHYLQDMQRARYHATPGVIDGRIYVIGGRKKQDA-DWVEVFDVTTE 189

  Fly   515 VW----TRIPN-------------MNHRRSGVSCVAFRNQLY 539
            .|    |:.||             |..|..||..:..::::|
plant   190 SWETVPTQCPNEASENGLFVTYAVMQGRILGVFLLTNQDKVY 231

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
klhl10NP_001015100.2 BTB 72..186 CDD:279045
PHA03098 86..610 CDD:222983 44/172 (26%)
BACK 195..298 CDD:285009