DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment klhl10 and AT2G29800

DIOPT Version :9

Sequence 1:NP_001015100.2 Gene:klhl10 / 3354863 FlyBaseID:FBgn0040038 Length:767 Species:Drosophila melanogaster
Sequence 2:NP_180541.1 Gene:AT2G29800 / 817530 AraportID:AT2G29800 Length:414 Species:Arabidopsis thaliana


Alignment Length:294 Identity:70/294 - (23%)
Similarity:104/294 - (35%) Gaps:84/294 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   372 RW----------VTINAEDPAGPRAYHGTAV-LGFKIFSIGGYDGVEY-------------FNTC 412
            ||          :.:|......|.....||| :|.||:.:|||: ..|             ||||
plant   128 RWFILQRRNNTSLKLNCVTSLPPMFLGCTAVTIGHKIYVVGGYN-FRYNKTISTVLEIDCRFNTC 191

  Fly   413 RVFDAVKKKWNEIAPMHCRRCYVSVTELNGMIYAIGG----YDGHNRLNTVERYNPRTNQWSVIP 473
            |....:|:.          ||......::|.||.:.|    :|     :.||.::..|.:|.::|
plant   192 RHLRNMKRD----------RCSAVAGVIDGRIYVVAGRQRRFD-----DWVEVFDVETERWELVP 241

  Fly   474 -PMNMQRSDASA----CTLQERIYATGGFNGQECLDSAEYYDPVTNVWTRIPNMNHRRSG---VS 530
             |.:...|.:..    ..|..:||...|       |....|||....|......:.:||.   .|
plant   242 GPFSSFASSSGKFIVHVVLDNKIYIMDG-------DYCFAYDPRRRRWETWGPESAQRSYWHLSS 299

  Fly   531 CVAFRNQLYVIGGFNGTARLSTGER---FDPDTQTWHFIREMNHSRSNFGLEIIDDMIF---AIG 589
            ||. .:.||.|     ..|...|..   :||....|         |...|||...::::   .:.
plant   300 CVV-DDLLYAI-----VPREIFGASIVVYDPRGIAW---------RPVMGLEFWPNLVYFESKMA 349

  Fly   590 GFNGVSTISHTECYVAETDEWMEATDMNIVRSAL 623
            .|.|...|  ..||.:..|.:.:  |:..|..||
plant   350 NFGGKLVI--LGCYRSSFDYYRK--DVWCVEVAL 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
klhl10NP_001015100.2 BTB 72..186 CDD:279045
PHA03098 86..610 CDD:222983 66/279 (24%)
BACK 195..298 CDD:285009
Kelch 347..394 CDD:128874 7/32 (22%)
KELCH repeat 385..428 CDD:276965 16/56 (29%)
Kelch 396..442 CDD:128874 14/58 (24%)
Kelch_1 431..476 CDD:279660 13/49 (27%)
KELCH repeat 432..475 CDD:276965 12/47 (26%)
KELCH repeat 479..523 CDD:276965 10/47 (21%)
Kelch 490..536 CDD:128874 13/48 (27%)
Kelch_1 525..570 CDD:279660 13/50 (26%)
KELCH repeat 526..571 CDD:276965 13/50 (26%)
Kelch_1 573..617 CDD:279660 11/46 (24%)
KELCH repeat 573..617 CDD:276965 11/46 (24%)
AT2G29800NP_180541.1 Kelch_1 151..198 CDD:279660 15/47 (32%)
KELCH repeat 154..197 CDD:276965 15/43 (35%)
Kelch_1 201..241 CDD:279660 11/44 (25%)
KELCH repeat 201..241 CDD:276965 11/44 (25%)
KELCH repeat 244..287 CDD:276965 10/49 (20%)
KELCH repeat 292..332 CDD:276965 14/54 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1072
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X9
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.