Sequence 1: | NP_001015100.2 | Gene: | klhl10 / 3354863 | FlyBaseID: | FBgn0040038 | Length: | 767 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_180520.1 | Gene: | AT2G29600 / 817509 | AraportID: | AT2G29600 | Length: | 415 | Species: | Arabidopsis thaliana |
Alignment Length: | 331 | Identity: | 64/331 - (19%) |
---|---|---|---|
Similarity: | 106/331 - (32%) | Gaps: | 123/331 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 329 QADELTTPPLAMPRLPHEVIFAIGGWSGGTSKGC------------------IETYDTRA----- 370
Fly 371 -----------------DRWVTINAEDPAG---------PRAYHG--TAVLGFKIFSIGGYDGV- 406
Fly 407 EYFNTCRVFDAVKKKWNEIAPMHCRRCYVSVTELNGMIYAIGGYDGHNRLNTVERYNPRTNQWSV 471
Fly 472 IP-----------PMNMQRSDASACTLQERIYATGGFN-----------------GQE------- 501
Fly 502 --C-LDSAEY--------------YDPVTNVWTRI------PNMNHRRSGVSCVAFRNQLYVIGG 543
Fly 544 FNGTAR 549 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
klhl10 | NP_001015100.2 | BTB | 72..186 | CDD:279045 | |
PHA03098 | 86..610 | CDD:222983 | 64/331 (19%) | ||
BACK | 195..298 | CDD:285009 | |||
Kelch | 347..394 | CDD:128874 | 10/97 (10%) | ||
KELCH repeat | 385..428 | CDD:276965 | 11/45 (24%) | ||
Kelch | 396..442 | CDD:128874 | 11/46 (24%) | ||
Kelch_1 | 431..476 | CDD:279660 | 16/55 (29%) | ||
KELCH repeat | 432..475 | CDD:276965 | 15/53 (28%) | ||
KELCH repeat | 479..523 | CDD:276965 | 15/90 (17%) | ||
Kelch | 490..536 | CDD:128874 | 16/92 (17%) | ||
Kelch_1 | 525..570 | CDD:279660 | 6/25 (24%) | ||
KELCH repeat | 526..571 | CDD:276965 | 6/24 (25%) | ||
Kelch_1 | 573..617 | CDD:279660 | |||
KELCH repeat | 573..617 | CDD:276965 | |||
AT2G29600 | NP_180520.1 | F-box | 60..103 | CDD:279040 | 7/46 (15%) |
Kelch_1 | 149..195 | CDD:279660 | 11/45 (24%) | ||
KELCH repeat | 152..194 | CDD:276965 | 11/41 (27%) | ||
Kelch_1 | 197..239 | CDD:279660 | 14/42 (33%) | ||
KELCH repeat | 198..241 | CDD:276965 | 15/43 (35%) | ||
NHL | <207..>295 | CDD:302697 | 21/94 (22%) | ||
NHL repeat | 247..282 | CDD:271320 | 7/40 (18%) | ||
KELCH repeat | 289..330 | CDD:276965 | 7/40 (18%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1072 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 1 | 1.000 | - | - | X9 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |