DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment klhl10 and AT2G22050

DIOPT Version :9

Sequence 1:NP_001015100.2 Gene:klhl10 / 3354863 FlyBaseID:FBgn0040038 Length:767 Species:Drosophila melanogaster
Sequence 2:NP_179796.2 Gene:AT2G22050 / 816740 AraportID:AT2G22050 Length:259 Species:Arabidopsis thaliana


Alignment Length:220 Identity:50/220 - (22%)
Similarity:86/220 - (39%) Gaps:44/220 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   294 MEEVKEHPYVLECEAAKPL--IVDTFKFMYDLDFLNPQADELTTPPLAMPR-------------L 343
            ::.|....|:..|..:|.|  :|           .:|:...|.|   .:|:             :
plant    43 LQRVPRSYYLNLCRVSKTLRSLV-----------RSPELSRLRT---LLPKNSVYVSFSQNIINV 93

  Fly   344 PHEVIFAIGGWSGGTSKGCIETYDTRADRWVTINAEDPAGPRAYHGTAVLGFKIFSIGGYDGVEY 408
            |.:.|:........|.|..::|:..:.   |.|....|:....|:.:|| |.:|:.:||  ..|.
plant    94 PPDTIYRWFTLKKKTMKTAMKTFRYKL---VKIPIPFPSHHSMYNSSAV-GSEIYFVGG--SFEP 152

  Fly   409 FNTCRVFDAVKKKWNEIAPMHCRRC-YVSVTELNGMIYAIGGYDGHNRLNTVERYNPRTNQWSVI 472
            .:...:.|.....:.:...|...|. ..||..:||.||.|||.:...:   ||.|:|::..|...
plant   153 MSELWILDTRTGMFRQGPSMKVARTDEASVGVINGKIYVIGGCEDKIQ---VEVYDPKSRSWKTT 214

  Fly   473 --PPMNMQR---SDASACTLQERIY 492
              |....||   :..||.:|..::|
plant   215 KDPEEKTQRGLMTRLSAVSLDWKVY 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
klhl10NP_001015100.2 BTB 72..186 CDD:279045
PHA03098 86..610 CDD:222983 50/220 (23%)
BACK 195..298 CDD:285009 0/3 (0%)
Kelch 347..394 CDD:128874 10/46 (22%)
KELCH repeat 385..428 CDD:276965 9/42 (21%)
Kelch 396..442 CDD:128874 9/46 (20%)
Kelch_1 431..476 CDD:279660 16/47 (34%)
KELCH repeat 432..475 CDD:276965 16/45 (36%)
KELCH repeat 479..523 CDD:276965 5/17 (29%)
Kelch 490..536 CDD:128874 1/3 (33%)
Kelch_1 525..570 CDD:279660
KELCH repeat 526..571 CDD:276965
Kelch_1 573..617 CDD:279660
KELCH repeat 573..617 CDD:276965
AT2G22050NP_179796.2 F-box 29..74 CDD:279040 7/41 (17%)
KELCH repeat 129..172 CDD:276965 9/45 (20%)
Kelch 143..187 CDD:128874 9/45 (20%)
KELCH repeat 176..220 CDD:276965 16/46 (35%)
Kelch_1 180..212 CDD:279660 13/34 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1072
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.