DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment klhl10 and AT2G22030

DIOPT Version :9

Sequence 1:NP_001015100.2 Gene:klhl10 / 3354863 FlyBaseID:FBgn0040038 Length:767 Species:Drosophila melanogaster
Sequence 2:NP_179794.1 Gene:AT2G22030 / 816738 AraportID:AT2G22030 Length:383 Species:Arabidopsis thaliana


Alignment Length:360 Identity:72/360 - (20%)
Similarity:110/360 - (30%) Gaps:146/360 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   219 LRYFTEVAYRNIDILDMSAEDFYSIISDDEL-NTR----EEDHVWKLC-----------VKWIDR 267
            |.....|:.|....|...::.|.|::...|| :.|    ::|.|..:|           :.|...
plant    35 LNCLARVSRRYYPNLSCVSKSFQSLVRSPELAHMRSLIGKDDPVVYVCFSDTKPFLGRRLDWFTL 99

  Fly   268 NPESRKRHVAHLMTGVRLGLMTPKCFMEEVKEHPYVLECEAAKPLIVDTFKF----MYDLDFLNP 328
            ||..:|..|.:..               :|..: |:|.|.:..  |.....|    ||..     
plant   100 NPNEKKTSVLNSF---------------QVFSY-YMLYCPSVS--IGSKIYFVGGCMYKC----- 141

  Fly   329 QADELTTPPLAMPRLPHEVIFAIGGWSGGTSKGCIETYDTRADRWVTINAEDPAGP-----RAYH 388
                          ||..:||  ..|||   :.|:                   ||     |...
plant   142 --------------LPGLLIF--DSWSG---ELCV-------------------GPSMKEARMLP 168

  Fly   389 GTAVLGFKIFSIGGYDGVEYFNTCR-------VFDAVKKKWNEIAPMH----------CRRCYVS 436
            |.||:..|::.:||         ||       |||...:.| |:.|:.          ..|....
plant   169 GVAVVNGKLYVMGG---------CREDQIQVEVFDPNSQTW-EVGPLSSDGEVRYGKGLMRYGAI 223

  Fly   437 VTE---LNGMIYAIGGYDGHNRLNTVERYNPRTNQWSVIPPMNMQRSDASA------CTLQERIY 492
            |||   |.|.:|.:...||.:.:     |:.:..:..     ....:|..|      |.:...||
plant   224 VTEAVALEGKVYCMSYKDGSHII-----YDTKDGKCE-----TFLMADGKAWRRGGVCVVNSVIY 278

  Fly   493 A----TGGFNGQECLDSAEYYDPVTNVWTRIPNMN 523
            .    .|          ..:|||...||..:..:|
plant   279 VYYINLG----------VMWYDPKDKVWREVKGLN 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
klhl10NP_001015100.2 BTB 72..186 CDD:279045
PHA03098 86..610 CDD:222983 72/360 (20%)
BACK 195..298 CDD:285009 17/94 (18%)
Kelch 347..394 CDD:128874 12/51 (24%)
KELCH repeat 385..428 CDD:276965 14/49 (29%)
Kelch 396..442 CDD:128874 16/65 (25%)
Kelch_1 431..476 CDD:279660 10/47 (21%)
KELCH repeat 432..475 CDD:276965 10/45 (22%)
KELCH repeat 479..523 CDD:276965 11/53 (21%)
Kelch 490..536 CDD:128874 9/38 (24%)
Kelch_1 525..570 CDD:279660
KELCH repeat 526..571 CDD:276965
Kelch_1 573..617 CDD:279660
KELCH repeat 573..617 CDD:276965
AT2G22030NP_179794.1 F-box 26..65 CDD:395521 6/29 (21%)
PHA02790 <120..204 CDD:165153 30/138 (22%)
KELCH repeat 121..161 CDD:276965 15/84 (18%)
Kelch_1 164..204 CDD:396078 14/49 (29%)
KELCH repeat 165..206 CDD:276965 15/50 (30%)
KELCH repeat 266..303 CDD:276965 9/46 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1072
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X9
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.