DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment klhl10 and AT2G20380

DIOPT Version :9

Sequence 1:NP_001015100.2 Gene:klhl10 / 3354863 FlyBaseID:FBgn0040038 Length:767 Species:Drosophila melanogaster
Sequence 2:NP_179628.1 Gene:AT2G20380 / 816557 AraportID:AT2G20380 Length:348 Species:Arabidopsis thaliana


Alignment Length:248 Identity:53/248 - (21%)
Similarity:87/248 - (35%) Gaps:81/248 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   333 LTTPPLAMPRLPHEVIFAIGGW--------SGGTSK--GCIETYDTRADRWVTINAEDPAGPRAY 387
            |.:||:..|.|     .|:|.:        ..|||.  .|:|.|:|....|:      |..|.. 
plant   111 LNSPPVEFPSL-----IAVGSYLYAFRAAIEEGTSDSLNCVEVYNTDTQTWI------PVPPNK- 163

  Fly   388 HGTAVLGFKIFSIGGYDGVEYFNTCRVFDAVKKKWNEIAPMHCRRCYVSVTELNGMIYAIGGYDG 452
                    :||.:....|:.|....::...|.:...|:||:..:...:..||             
plant   164 --------RIFKLQHMKGMLYMKVSKLLSFVAQDAEELAPLFPKLRSLLSTE------------- 207

  Fly   453 HNRLNTVERYNPRTNQ-WSVIP-PMNMQRSDASACTLQERIYATGGFNGQECLDSAEYYDP-VTN 514
                  |..:.|:.:: :.|:. .:|......|.|.::|..|               :||| |..
plant   208 ------VVAFKPKVSEGYEVLGFSVNTDLGRGSFCMIEEITY---------------HYDPSVKF 251

  Fly   515 VWTRIPNMNHRRSGVSCVAFRNQLYVIGGFNGTARLSTGERFDPDTQ---TWH 564
            .|.|      |:.||    :|: |..:.|....||.|:.:..|...:   .||
plant   252 RWRR------RQGGV----WRS-LVGLEGLPKFARYSSVKLADCGGKLVVLWH 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
klhl10NP_001015100.2 BTB 72..186 CDD:279045
PHA03098 86..610 CDD:222983 53/248 (21%)
BACK 195..298 CDD:285009
Kelch 347..394 CDD:128874 12/56 (21%)
KELCH repeat 385..428 CDD:276965 7/42 (17%)
Kelch 396..442 CDD:128874 10/45 (22%)
Kelch_1 431..476 CDD:279660 5/46 (11%)
KELCH repeat 432..475 CDD:276965 5/44 (11%)
KELCH repeat 479..523 CDD:276965 10/44 (23%)
Kelch 490..536 CDD:128874 10/46 (22%)
Kelch_1 525..570 CDD:279660 12/43 (28%)
KELCH repeat 526..571 CDD:276965 11/42 (26%)
Kelch_1 573..617 CDD:279660
KELCH repeat 573..617 CDD:276965
AT2G20380NP_179628.1 F-box 19..62 CDD:279040
Kelch_6 118..161 CDD:290672 13/53 (25%)
KELCH repeat 120..161 CDD:276965 12/51 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1072
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X9
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.