DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment klhl10 and KLHDC8A

DIOPT Version :9

Sequence 1:NP_001015100.2 Gene:klhl10 / 3354863 FlyBaseID:FBgn0040038 Length:767 Species:Drosophila melanogaster
Sequence 2:NP_001258792.1 Gene:KLHDC8A / 55220 HGNCID:25573 Length:350 Species:Homo sapiens


Alignment Length:299 Identity:78/299 - (26%)
Similarity:127/299 - (42%) Gaps:31/299 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   348 IFAIGGW-SGGTSKGCIETYDTRADRWVTINAEDPAGPRAYHGTAV--LGFKIFSIGGYDGVEY- 408
            ::||||. ..|....|.|.|...||:|..:    |..|.|..|.||  ||.:|..|||....:. 
Human    33 VYAIGGCDDNGVPMDCFEVYSPEADQWTAL----PRLPTARAGVAVTALGKRIMVIGGVGTNQLP 93

  Fly   409 FNTCRVFDAVKKKWNEIAPMHCRRCYVSVTELNGMIYAIGGYD----GHNRLNTVERYNPRTNQW 469
            .....:::..:.||.:.:.:......:|||..:..:||.||..    .||.|   :.|:...:.|
Human    94 LKVVEMYNIDEGKWKKRSMLREAAMGISVTAKDYRVYAAGGMGLDLRPHNHL---QHYDMLKDMW 155

  Fly   470 SVIPPMNMQRSDASACTLQERIYATGGFNGQECLDSAEYYDPVTNVWTRIPNMNHRRSGVSCVAF 534
            ..:.||...|..|::.....:||..||...:..:::.|.:|..|..||:.||:.::|:..|.|..
Human   156 VSLAPMPTPRYAATSFLRGSKIYVLGGRQSKYAVNAFEVFDIETRSWTKFPNIPYKRAFSSFVTL 220

  Fly   535 RNQLYVIGG------FNGTARLSTGERFDPDTQTW------HFIREMNHSRSNFGLEIIDDMIFA 587
            .|.||.:||      :.....|.|.:.||.:...|      .|:::   .|::|....:...:..
Human   221 DNHLYSLGGLRQGRLYRQPKFLRTMDVFDMEQGGWLKMERSFFLKK---RRADFVAGSLSGRVIV 282

  Fly   588 IGGFNGVSTISHT-ECYVAETDEWMEATDMNIVRSALSA 625
            .||.....|:..| |.:....::|.....|...|.|.|:
Human   283 AGGLGNQPTVLETAEAFHPGKNKWEILPAMPTPRCACSS 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
klhl10NP_001015100.2 BTB 72..186 CDD:279045
PHA03098 86..610 CDD:222983 73/282 (26%)
BACK 195..298 CDD:285009
Kelch 347..394 CDD:128874 17/48 (35%)
KELCH repeat 385..428 CDD:276965 12/45 (27%)
Kelch 396..442 CDD:128874 9/46 (20%)
Kelch_1 431..476 CDD:279660 13/48 (27%)
KELCH repeat 432..475 CDD:276965 12/46 (26%)
KELCH repeat 479..523 CDD:276965 13/43 (30%)
Kelch 490..536 CDD:128874 14/45 (31%)
Kelch_1 525..570 CDD:279660 14/56 (25%)
KELCH repeat 526..571 CDD:276965 14/56 (25%)
Kelch_1 573..617 CDD:279660 8/44 (18%)
KELCH repeat 573..617 CDD:276965 8/44 (18%)
KLHDC8ANP_001258792.1 Kelch 1 1..31
BTB <5..209 CDD:333434 52/182 (29%)
KELCH repeat 21..65 CDD:276965 12/35 (34%)
Kelch 2 32..79 18/49 (37%)
KELCH repeat 69..162 CDD:276965 24/95 (25%)
Kelch 3 81..127 9/45 (20%)
Kelch 4 128..175 13/49 (27%)
BTB <129..333 CDD:333434 50/199 (25%)
KELCH repeat 165..210 CDD:276965 13/44 (30%)
Kelch 5 176..222 14/45 (31%)
Kelch 6 224..278 12/56 (21%)
KELCH repeat 268..314 CDD:276965 9/45 (20%)
Kelch 7 279..326 10/43 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1072
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X9
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.