DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment klhl10 and Klhl42

DIOPT Version :9

Sequence 1:NP_001015100.2 Gene:klhl10 / 3354863 FlyBaseID:FBgn0040038 Length:767 Species:Drosophila melanogaster
Sequence 2:NP_001102727.1 Gene:Klhl42 / 500367 RGDID:1560924 Length:493 Species:Rattus norvegicus


Alignment Length:408 Identity:97/408 - (23%)
Similarity:167/408 - (40%) Gaps:74/408 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   279 LMTGVRLGLMTPKCFMEEVKEHPYVLECEAAKPLIVDT-FKFM---YDLDFLNPQADELTTPPLA 339
            |::.||||    .|.      ..|.|......|.:.|. .:||   :......||...|.:||.|
  Rat   109 LLSHVRLG----NCL------ELYRLAQVYGLPDLQDACLRFMVLRFHQVLCQPQFPLLLSPPQA 163

  Fly   340 --------------MPRLPHEVIFAIGGWSGGT--------SKGCIETYDTRADRWVTIN---AE 379
                          |...|  |:.|:|.:.||.        ....:..|:...:||..:.   ..
  Rat   164 PGDCSLKQRLREARMRGTP--VLVALGDFLGGPLAPHPYQGEPPSMLRYEETTERWFPLANNLPP 226

  Fly   380 DPAGPRAYHGTAVLGFKIFSIGGYD-GVEYFNTCRVFDAVKKKWNEIAPMHCRRCYVSVTELNGM 443
            |....|.| |:|:|...:|.:|||. ..:..:....::....:|.::|.|:.:|....:..:|..
  Rat   227 DLVNVRGY-GSAILDNYLFIVGGYRITSQEISAAHSYNPTTNEWLQVASMNQKRSNFKLVAVNSK 290

  Fly   444 IYAIGGYDGHNRLNTVERYNPRTNQWSVIPPMNMQRSDASACTLQERIYATGGFNGQECLDSAEY 508
            :|||||    ..::.||.|||..:.|:.:.|:....::.|||..:.:||..||:..::...:...
  Rat   291 LYAIGG----QAVSNVECYNPEQDAWNFVAPLPNPLAEFSACECKGKIYVIGGYTTRDRNMNILQ 351

  Fly   509 YDPVTNVWTRIPNMNHRRSGVSCVAFRNQLYVIGGF---NGTARLS-------TGERFDPDTQTW 563
            |.|..::||.....:........|:....:|::||.   .|:.|.|       |.:.::.:|:.|
  Rat   352 YCPSADLWTLFETCDVHIRKQQMVSVEETIYIVGGCLHELGSNRRSSQSEDMLTVQSYNTETRQW 416

  Fly   564 HFIREMNHSRSNFGL--EIIDDMIFAIGGFNGVST-ISHTEC--YVAETDEW-----MEATDMNI 618
            .:::| |.|:|...|  .:.:|.|:.:.....:|| :.|...  |....|.|     ..|...|:
  Rat   417 LYLKE-NTSKSGLNLTCALHNDGIYIMSRDVTLSTSLEHRVFLKYNIFADSWEAFRRFPAFGHNL 480

  Fly   619 VRSALSANNIAGLPNKRD 636
            :.|:|.      ||||.:
  Rat   481 LISSLY------LPNKAE 492

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
klhl10NP_001015100.2 BTB 72..186 CDD:279045
PHA03098 86..610 CDD:222983 88/375 (23%)
BACK 195..298 CDD:285009 6/18 (33%)
Kelch 347..394 CDD:128874 13/57 (23%)
KELCH repeat 385..428 CDD:276965 11/43 (26%)
Kelch 396..442 CDD:128874 8/46 (17%)
Kelch_1 431..476 CDD:279660 14/44 (32%)
KELCH repeat 432..475 CDD:276965 13/42 (31%)
KELCH repeat 479..523 CDD:276965 11/43 (26%)
Kelch 490..536 CDD:128874 9/45 (20%)
Kelch_1 525..570 CDD:279660 11/54 (20%)
KELCH repeat 526..571 CDD:276965 11/54 (20%)
Kelch_1 573..617 CDD:279660 11/53 (21%)
KELCH repeat 573..617 CDD:276965 11/53 (21%)
Klhl42NP_001102727.1 BTB_POZ_KLHL42 4..101 CDD:349628
BACK_KLHL42_KLHDC5 113..225 CDD:350553 27/123 (22%)
KELCH repeat 179..223 CDD:276965 9/45 (20%)
PHA03098 <198..485 CDD:222983 67/292 (23%)
KELCH repeat 232..275 CDD:276965 11/43 (26%)
KELCH repeat 279..319 CDD:276965 14/43 (33%)
KELCH repeat 322..360 CDD:276965 9/37 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1072
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.