| Sequence 1: | NP_001015100.2 | Gene: | klhl10 / 3354863 | FlyBaseID: | FBgn0040038 | Length: | 767 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001094832.1 | Gene: | KBTBD13 / 390594 | HGNCID: | 37227 | Length: | 458 | Species: | Homo sapiens |
| Alignment Length: | 271 | Identity: | 64/271 - (23%) |
|---|---|---|---|
| Similarity: | 103/271 - (38%) | Gaps: | 57/271 - (21%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 367 DTRADRWVTINAEDPAGPRAYHGTAVLGFKIFSIGGYDG----VEYFNTCRVFDAVKKKWNEIAP 427
Fly 428 MHCRRCYVSVTELNGMIYAIGGYDGHNRLNTVERYNPRTNQWSVIPPMNMQRSD---ASACTLQE 489
Fly 490 RIYATGGFNGQECL------DSAEYYDPVTNVWTRIPNMNHRRSGVSC-VAFRNQLYVIGGFNGT 547
Fly 548 A-----------RLSTGERFDPDTQTWHFI--REMNHSRSNFGLEIIDDMIFAIGGFNGVSTISH 599
Fly 600 TECYVAETDEW 610 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| klhl10 | NP_001015100.2 | BTB | 72..186 | CDD:279045 | |
| PHA03098 | 86..610 | CDD:222983 | 63/269 (23%) | ||
| BACK | 195..298 | CDD:285009 | |||
| Kelch | 347..394 | CDD:128874 | 7/26 (27%) | ||
| KELCH repeat | 385..428 | CDD:276965 | 13/46 (28%) | ||
| Kelch | 396..442 | CDD:128874 | 11/49 (22%) | ||
| Kelch_1 | 431..476 | CDD:279660 | 14/44 (32%) | ||
| KELCH repeat | 432..475 | CDD:276965 | 14/42 (33%) | ||
| KELCH repeat | 479..523 | CDD:276965 | 9/52 (17%) | ||
| Kelch | 490..536 | CDD:128874 | 10/52 (19%) | ||
| Kelch_1 | 525..570 | CDD:279660 | 14/58 (24%) | ||
| KELCH repeat | 526..571 | CDD:276965 | 14/58 (24%) | ||
| Kelch_1 | 573..617 | CDD:279660 | 7/38 (18%) | ||
| KELCH repeat | 573..617 | CDD:276965 | 7/38 (18%) | ||
| KBTBD13 | NP_001094832.1 | BTB | 7..101 | CDD:295341 | |
| BTB | 13..101 | CDD:197585 | |||
| Kelch 1 | 159..209 | 8/27 (30%) | |||
| Kelch_1 | 202..244 | CDD:279660 | 13/43 (30%) | ||
| KELCH repeat | 202..244 | CDD:276965 | 13/43 (30%) | ||
| Kelch 2 | 210..258 | 11/49 (22%) | |||
| Kelch_1 | 247..292 | CDD:279660 | 14/44 (32%) | ||
| KELCH repeat | 248..292 | CDD:276965 | 14/43 (33%) | ||
| Kelch 3 | 259..305 | 15/48 (31%) | |||
| KELCH repeat | 295..336 | CDD:276965 | 9/51 (18%) | ||
| Kelch 4 | 307..350 | 9/50 (18%) | |||
| KELCH repeat | 340..383 | CDD:276965 | 14/52 (27%) | ||
| Kelch 5 | 352..400 | 11/57 (19%) | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG1072 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||