DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment klhl10 and IPP

DIOPT Version :10

Sequence 1:NP_001015100.2 Gene:klhl10 / 3354863 FlyBaseID:FBgn0040038 Length:767 Species:Drosophila melanogaster
Sequence 2:NP_005888.1 Gene:IPP / 3652 HGNCID:6108 Length:584 Species:Homo sapiens


Alignment Length:35 Identity:10/35 - (28%)
Similarity:16/35 - (45%) Gaps:2/35 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 WHNNGVRLSF--PRAESSINITMGCTLQRGIAKSL 79
            |:.:|:...|  |....|:...:|..|..||..:|
Human   138 WNLHGILRDFYSPLVPDSMKFEIGEALYLGIISAL 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
klhl10NP_001015100.2 BTB_POZ 62..>108 CDD:453885 6/18 (33%)
PHA03098 86..610 CDD:222983
KELCH repeat 385..428 CDD:276965
KELCH repeat 432..475 CDD:276965
KELCH repeat 479..523 CDD:276965
KELCH repeat 526..571 CDD:276965
KELCH repeat 573..617 CDD:276965
IPPNP_005888.1 BTB_POZ_KLHL27_IPP 17..141 CDD:349565 1/2 (50%)
PHA03098 30..575 CDD:222983 10/35 (29%)
Kelch 1 289..343
KELCH repeat 333..376 CDD:276965
Kelch 2 344..390
KELCH repeat 380..424 CDD:276965
Kelch 3 391..437
KELCH repeat 427..473 CDD:276965
Kelch 4 439..485
KELCH repeat 475..520 CDD:276965
Kelch 5 487..533
KELCH repeat 523..574 CDD:276965
Kelch 6 535..583
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.