DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment klhl10 and AT4G19330

DIOPT Version :9

Sequence 1:NP_001015100.2 Gene:klhl10 / 3354863 FlyBaseID:FBgn0040038 Length:767 Species:Drosophila melanogaster
Sequence 2:NP_001319995.1 Gene:AT4G19330 / 28720147 AraportID:AT4G19330 Length:383 Species:Arabidopsis thaliana


Alignment Length:214 Identity:48/214 - (22%)
Similarity:72/214 - (33%) Gaps:65/214 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   422 WNEIAPMHCRRCYVSVTELNGM-IYAIGGYDGHNRLNTVERYNPRTNQW---------SVIPPMN 476
            |....|....||...|.|..|. .|.|||          :...|.|:.|         ...|.|.
plant   125 WLLPMPSPYSRCLQIVHETVGSETYEIGG----------QNMTPSTDVWVYDKLIGKQRKAPSMM 179

  Fly   477 MQRSDASACTLQERIYATGGFNGQECLDSAEYYDPVTNVWTRIPN--MNHRRSGVSCVAFR-NQL 538
            :.|.:|..|.|..::|..||....|....||.:||.|..|..:|:  :..|.|.|..:..: .::
plant   180 VARKNAFTCVLDGKLYVMGGCEADESTHWAEVFDPKTQTWEALPDPGVELRYSSVKNIQTKQGKV 244

  Fly   539 YVIGGFNGTARLSTGERFDPDTQTWHFIREMNHSRSNFGLEIIDDMIFAIGGFN-GVSTIS-HTE 601
            ||                             ..::.|| :.:|.:.::.:...| |.||.. ...
plant   245 YV-----------------------------RSNKKNF-VYLIKECMWEVAEENLGESTCEIENV 279

  Fly   602 CYV----------AETDEW 610
            ||.          |:.:||
plant   280 CYCYSNKRYWWYDAKCEEW 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
klhl10NP_001015100.2 BTB 72..186 CDD:279045
PHA03098 86..610 CDD:222983 46/212 (22%)
BACK 195..298 CDD:285009
Kelch 347..394 CDD:128874
KELCH repeat 385..428 CDD:276965 1/5 (20%)
Kelch 396..442 CDD:128874 6/19 (32%)
Kelch_1 431..476 CDD:279660 13/54 (24%)
KELCH repeat 432..475 CDD:276965 13/52 (25%)
KELCH repeat 479..523 CDD:276965 15/45 (33%)
Kelch 490..536 CDD:128874 14/48 (29%)
Kelch_1 525..570 CDD:279660 5/45 (11%)
KELCH repeat 526..571 CDD:276965 4/45 (9%)
Kelch_1 573..617 CDD:279660 12/50 (24%)
KELCH repeat 573..617 CDD:276965 12/50 (24%)
AT4G19330NP_001319995.1 F-box 34..76 CDD:306992
BTB <122..241 CDD:333434 34/125 (27%)
NanM 180..>326 CDD:330881 32/149 (21%)
Kelch_1 181..226 CDD:279660 15/44 (34%)
KELCH repeat 182..224 CDD:276965 14/41 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1072
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X9
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.