Sequence 1: | NP_001015100.2 | Gene: | klhl10 / 3354863 | FlyBaseID: | FBgn0040038 | Length: | 767 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001319995.1 | Gene: | AT4G19330 / 28720147 | AraportID: | AT4G19330 | Length: | 383 | Species: | Arabidopsis thaliana |
Alignment Length: | 214 | Identity: | 48/214 - (22%) |
---|---|---|---|
Similarity: | 72/214 - (33%) | Gaps: | 65/214 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 422 WNEIAPMHCRRCYVSVTELNGM-IYAIGGYDGHNRLNTVERYNPRTNQW---------SVIPPMN 476
Fly 477 MQRSDASACTLQERIYATGGFNGQECLDSAEYYDPVTNVWTRIPN--MNHRRSGVSCVAFR-NQL 538
Fly 539 YVIGGFNGTARLSTGERFDPDTQTWHFIREMNHSRSNFGLEIIDDMIFAIGGFN-GVSTIS-HTE 601
Fly 602 CYV----------AETDEW 610 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
klhl10 | NP_001015100.2 | BTB | 72..186 | CDD:279045 | |
PHA03098 | 86..610 | CDD:222983 | 46/212 (22%) | ||
BACK | 195..298 | CDD:285009 | |||
Kelch | 347..394 | CDD:128874 | |||
KELCH repeat | 385..428 | CDD:276965 | 1/5 (20%) | ||
Kelch | 396..442 | CDD:128874 | 6/19 (32%) | ||
Kelch_1 | 431..476 | CDD:279660 | 13/54 (24%) | ||
KELCH repeat | 432..475 | CDD:276965 | 13/52 (25%) | ||
KELCH repeat | 479..523 | CDD:276965 | 15/45 (33%) | ||
Kelch | 490..536 | CDD:128874 | 14/48 (29%) | ||
Kelch_1 | 525..570 | CDD:279660 | 5/45 (11%) | ||
KELCH repeat | 526..571 | CDD:276965 | 4/45 (9%) | ||
Kelch_1 | 573..617 | CDD:279660 | 12/50 (24%) | ||
KELCH repeat | 573..617 | CDD:276965 | 12/50 (24%) | ||
AT4G19330 | NP_001319995.1 | F-box | 34..76 | CDD:306992 | |
BTB | <122..241 | CDD:333434 | 34/125 (27%) | ||
NanM | 180..>326 | CDD:330881 | 32/149 (21%) | ||
Kelch_1 | 181..226 | CDD:279660 | 15/44 (34%) | ||
KELCH repeat | 182..224 | CDD:276965 | 14/41 (34%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1072 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 1 | 1.000 | - | - | X9 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |