DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment klhl10 and KLHDC7A

DIOPT Version :9

Sequence 1:NP_001015100.2 Gene:klhl10 / 3354863 FlyBaseID:FBgn0040038 Length:767 Species:Drosophila melanogaster
Sequence 2:NP_689588.2 Gene:KLHDC7A / 127707 HGNCID:26791 Length:777 Species:Homo sapiens


Alignment Length:549 Identity:104/549 - (18%)
Similarity:167/549 - (30%) Gaps:243/549 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 GFNADTPGCVD-------GSDAKK-------NNNFIHIPGVSSCIMNCVIQYAYLRQTNISESNV 163
            ||....|.|.|       |..:::       ..||.|||          :..|...|..:...|.
Human   381 GFRLPAPPCPDPGALPGLGRSSREPHVQPVAGTNFFHIP----------LTPASAPQVRLDLGNC 435

  Fly   164 HELLICADYVGMVGLVKKC-----KDYLGRILTPE--NCVSIMGFARFRFLEDLHLKARNYTLRY 221
            :|:|..|....:..|.:..     ::||..:.:|:  .|:|  |..|...|: ..|:.|.|.:  
Human   436 YEVLTLAKRQNLEALKEAAYKVMSENYLQVLRSPDIYGCLS--GAERELILQ-RRLRGRQYLV-- 495

  Fly   222 FTEVAYRNIDILDM-SAEDFYSIISDDELNTREEDHVWKLCVKWIDRNPESRKRHVAHLMTGVRL 285
                      :.|: ..||...:...|     :|..||:                          
Human   496 ----------VADVCPKEDSGGLCCYD-----DEQDVWR-------------------------- 519

  Fly   286 GLMTPKCFMEEVKEHPYVLECEAAKPLIVDTFKFMYDLDFLNPQADELTTPPLAMPRLPHEVIFA 350
                                                               |||  |:|.|.:  
Human   520 ---------------------------------------------------PLA--RMPPEAV-- 529

  Fly   351 IGGWSGGTSKGCIETYDTRADRWVTINAEDPAGPRAYHGTAVLGFKIFSIGGYDGVEYFNTCRVF 415
                    |:||                          ....|...:|.:.|..|..:..:.|||
Human   530 --------SRGC--------------------------AICSLFNYLFVVSGCQGPGHQPSSRVF 560

  Fly   416 --DAVKKKWNEIAPMHCRRCYVSVTELNGMIYAIGGYDGHNRLNTVERYNPRTNQWSVIPPMNMQ 478
              :.:...|:|:.|::..|.:..:..|:|.:|||||    ..||:||||:||.::|...||:   
Human   561 CYNPLTGIWSEVCPLNQARPHCRLVALDGHLYAIGG----ECLNSVERYDPRLDRWDFAPPL--- 618

  Fly   479 RSDA-----SACTLQERIYATGG--------FNGQECLDSAEYYDPVTNVWTRIPNMNHRRSGVS 530
            .||.     :|....:.|:.|||        |:.||            ..|...|....:.....
Human   619 PSDTFALAHTATVRAKEIFVTGGSLRFLLFRFSAQE------------QRWWAGPTGGSKDRTAE 671

  Fly   531 CVAFRNQLYVIGGFNGTARLSTGERFD-------------PDTQTWHFIREMNHSRS----NFGL 578
            .||....||               |||             ..|:.|:   |....|:    .|..
Human   672 MVAVNGFLY---------------RFDLNRSLGIAVYRCSASTRLWY---ECATYRTPYPDAFQC 718

  Fly   579 EIIDDMIFAIGGFNGVSTISHTECYVAET 607
            .::|::|:.:|.       ..|.|::|::
Human   719 AVVDNLIYCVGR-------RSTLCFLADS 740

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
klhl10NP_001015100.2 BTB 72..186 CDD:279045 18/91 (20%)
PHA03098 86..610 CDD:222983 104/549 (19%)
BACK 195..298 CDD:285009 15/103 (15%)
Kelch 347..394 CDD:128874 3/46 (7%)
KELCH repeat 385..428 CDD:276965 9/44 (20%)
Kelch 396..442 CDD:128874 11/47 (23%)
Kelch_1 431..476 CDD:279660 19/44 (43%)
KELCH repeat 432..475 CDD:276965 18/42 (43%)
KELCH repeat 479..523 CDD:276965 12/56 (21%)
Kelch 490..536 CDD:128874 11/53 (21%)
Kelch_1 525..570 CDD:279660 10/57 (18%)
KELCH repeat 526..571 CDD:276965 10/57 (18%)
Kelch_1 573..617 CDD:279660 8/39 (21%)
KELCH repeat 573..617 CDD:276965 8/39 (21%)
KLHDC7ANP_689588.2 BACK_like 430..>470 CDD:297737 7/39 (18%)
KELCH repeat 531..575 CDD:276965 11/69 (16%)
Kelch 542..589 CDD:128874 11/46 (24%)
Kelch_1 578..619 CDD:279660 19/47 (40%)
KELCH repeat 579..619 CDD:276965 19/46 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1072
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.