DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15408 and SIT1

DIOPT Version :9

Sequence 1:NP_608767.1 Gene:CG15408 / 33548 FlyBaseID:FBgn0031523 Length:466 Species:Drosophila melanogaster
Sequence 2:NP_010849.3 Gene:SIT1 / 856644 SGDID:S000000791 Length:628 Species:Saccharomyces cerevisiae


Alignment Length:421 Identity:76/421 - (18%)
Similarity:120/421 - (28%) Gaps:198/421 - (47%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 VKSEFE--------------ISWVGSMLGMGSVTGNILIGCLL------GRLGSKRCLLLIAIPH 102
            :|.|||              ..|...::||..:|  :..||:|      |.|..:.....|.:|.
Yeast   259 LKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLIT--VFFGCVLVPFTLAGGLKEEWKTAHIIVPE 321

  Fly   103 SCFWILV---YFAQSVEYLYVGRLLAGICGGGMYIVHPI----LLSEIADANIRGTFSAMVMLSV 160
            ...|::|   |....::|..                ||:    |:.:      ||.|.|      
Yeast   322 VIGWVVVLPLYMLWEIKYSR----------------HPLTPWDLIQD------RGIFFA------ 358

  Fly   161 NVGILVGYIIGTHLPYYSIPLMVLILPLWYLISVLLFIKESPMHLIRIGKYSAAERSFRYYKNIK 225
               :|:.:.|..:               ||:                .|.|.........:::||
Yeast   359 ---LLIAFFINFN---------------WYM----------------QGDYMYTVLVVAVHESIK 389

  Fly   226 DSDNIHDQNRAME-------EFEIMKIALTKGDALQDAVTFKDFYSRPALKAYGPALVLLIANQF 283
            .:..|......:.       .|.::|:..||                       |.::..|:...
Yeast   390 SATRITSLYSFVSVIVGTILGFILIKVRRTK-----------------------PFIIFGISCWI 431

  Fly   284 SGLFTMVNYMSDIFANSGSTMDPDTCTIIIGAVQILG------TYVTTLLCDICGRKLLMLVSTG 342
            .....:|:|..|..|:||          |||::.:||      ||||........:....:    
Yeast   432 VSFGLLVHYRGDSGAHSG----------IIGSLCLLGFGAGSFTYVTQASIQASAKTHARM---- 482

  Fly   343 GVAISLTAFGFFTKYAESHNIGE------------------------------------------ 365
            .|..||        |..::|||.                                          
Yeast   483 AVVTSL--------YLATYNIGSAFGSSVSGAVWTNILPKEISKRISDPTLAAQAYGSPFTFITT 539

  Fly   366 YSW-IP---LLLMS---MDIFLGNIGLVGCF 389
            |:| .|   .|:||   :...|..||||.||
Yeast   540 YTWGTPERIALVMSYRYVQKILCIIGLVFCF 570

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15408NP_608767.1 2A0115 17..410 CDD:273327 76/421 (18%)
MFS 60..455 CDD:119392 75/419 (18%)
SIT1NP_010849.3 MFS_ARN_like 70..582 CDD:340880 76/421 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0254
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.