DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15408 and ARN2

DIOPT Version :9

Sequence 1:NP_608767.1 Gene:CG15408 / 33548 FlyBaseID:FBgn0031523 Length:466 Species:Drosophila melanogaster
Sequence 2:NP_011816.2 Gene:ARN2 / 856338 SGDID:S000001039 Length:620 Species:Saccharomyces cerevisiae


Alignment Length:361 Identity:68/361 - (18%)
Similarity:125/361 - (34%) Gaps:123/361 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 DANIRGTFSAMVMLSVNVGILVGYIIGTHLPYYSIPLMVLILP-----------------LWYLI 192
            |::||||:....|.|.:...|:.          ::.::||::.                 ..:|:
Yeast    86 DSSIRGTYMTYAMNSYSAHSLIS----------TVSVIVLMISAVSQVIFGGLSDIFGRLTLFLV 140

  Fly   193 SVLLFIKESPMHLIR-----IGKYSAAERSFRYYKNIKDSDNIHDQNRAMEEFEIMKIALTKGDA 252
            |::|:|..:   :|:     :.:|:|.  :..||..:..              .::::.|...| 
Yeast   141 SIVLYIVGT---IIQSQAYDVQRYAAG--AVFYYVGLVG--------------VMLQVVLMLSD- 185

  Fly   253 LQDAVTFKDFY----SRPA-LKAYGPALVLLIANQFSGLFTMVNYMSDIFANSGSTMDPDTCTII 312
             ..::.::.||    |.|: :..:....|:..||........:...:.||        |..|..:
Yeast   186 -NSSLKWRLFYTLIPSWPSIITTWVSGSVVEAANPLENWSWNIAMWAFIF--------PLCCIPL 241

  Fly   313 I-----------------------------GAVQILGTYVTTLLCDICGRKLLMLVSTGGVAISL 348
            |                             |.||:|......|  |:.| .||.....|.:.:.|
Yeast   242 ILCMLHMRWKVRNDVEWKELQDEKSYYQTHGLVQMLVQLFWKL--DVVG-VLLFTAGVGCILVPL 303

  Fly   349 T-AFGFFTKYAESHNIGEYSWIPLLLMSMDIFLGNIGLVGCFF----VSLVEMFPVKI---RAKA 405
            | |.|..|.:..|..||.:            .||.:.:.|..:    ::||...|.|:   |...
Yeast   304 TLAGGVSTNWRNSKIIGPF------------VLGFVLVPGFIYWESRLALVPFAPFKLLKDRGVW 356

  Fly   406 ASMAIVVCSIFVFLM-----LNIFPICMKQWGISAT 436
            |.:.|:....||:.|     ..|..:.:.:...|||
Yeast   357 APLGIMFFICFVYQMAAGYLYTILVVAVDESASSAT 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15408NP_608767.1 2A0115 17..410 CDD:273327 60/328 (18%)
MFS 60..455 CDD:119392 68/361 (19%)
ARN2NP_011816.2 MFS_ARN_like 69..581 CDD:340880 68/361 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0254
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.