DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15408 and SGE1

DIOPT Version :9

Sequence 1:NP_608767.1 Gene:CG15408 / 33548 FlyBaseID:FBgn0031523 Length:466 Species:Drosophila melanogaster
Sequence 2:NP_015524.1 Gene:SGE1 / 856327 SGDID:S000006402 Length:543 Species:Saccharomyces cerevisiae


Alignment Length:484 Identity:90/484 - (18%)
Similarity:159/484 - (32%) Gaps:172/484 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 CLLNRRNRYQLLTTL------LINVISISHGIGIGWLSPTLRKLQSDSPAGFEVKSEF-EISWVG 68
            |:::      ||.||      ::.|:::...|||.:                   .:| .|.|:.
Yeast    10 CVIS------LLLTLFLAALDIVIVVTLYDTIGIKF-------------------HDFGNIGWLV 49

  Fly    69 SMLGMGSVTGNILIGCLLGRLGSKRCLLLIAIPHSCFWILVYFAQSVEYLYVGRLLAGICGGGMY 133
            :...:.:....:|.|.|...||:|.||::..|......::...:.|:..|..||::||..|.|:.
Yeast    50 TGYALSNAVFMLLWGRLAEILGTKECLMISVIVFEIGSLISALSNSMATLISGRVVAGFGGSGIE 114

  Fly   134 IVHPILLSEIADANIRGTFSAMVMLSV----NVGILVGYIIGTHLP-----YYSIPLMVLILPLW 189
            .:..::.:.|...|.||.....:.:|.    .||..:|.....||.     |.::|:..      
Yeast   115 SLAFVVGTSIVRENHRGIMITALAISYVIAEGVGPFIGGAFNEHLSWRWCFYINLPIGA------ 173

  Fly   190 YLISVLLFIKES---------PMHLIRIGKYSAAE-RSFRYYKNIKDSDNIHDQNRAMEEFEIMK 244
            :...:|.|...|         |..:.:|..|...| ....::||               .||::.
Yeast   174 FAFIILAFCNTSGEPHQKMWLPSKIKKIMNYDYGELLKASFWKN---------------TFEVLV 223

  Fly   245 IALTKGDALQDAVTFKDFYSRPALKAYGPALVLLIANQFSGLFTMVNYMSDIFANSGSTMDPDTC 309
            ..|.....:..:..|               .:|::...|.|        ::...|||..:    |
Yeast   224 FKLDMVGIILSSAGF---------------TLLMLGLSFGG--------NNFPWNSGIII----C 261

  Fly   310 TIIIGAVQILGTYVTTLLCDICGRKLLMLVSTGGVAISLTAFGFFTKYAESHNIGEYSWIPLLLM 374
            ...:|.:         ||...|......|        ||:...:..|..:          |||..
Yeast   262 FFTVGPI---------LLLLFCAYDFHFL--------SLSGLHYDNKRIK----------PLLTW 299

  Fly   375 SM----DIFLGNI-GLVGCFFVSL---------------------VEMFPVKIRAKAASMAI--- 410
            ::    .||..:| |.:.||...|                     :.::.:.|.|..|:|||   
Yeast   300 NIASNCGIFTSSITGFLSCFAYELQSAYLVQLYQLVFKKKPTLASIHLWELSIPAMIATMAIAYL 364

  Fly   411 --------------VVCSIF---VFLMLN 422
                          |:|.|.   :|.::|
Yeast   365 NSKYGIIKPAIVFGVLCGIVGSGLFTLIN 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15408NP_608767.1 2A0115 17..410 CDD:273327 82/444 (18%)
MFS 60..455 CDD:119392 81/429 (19%)
SGE1NP_015524.1 MFS_Azr1_MDR_like 24..531 CDD:341045 85/464 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0254
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.