DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15408 and AMF1

DIOPT Version :9

Sequence 1:NP_608767.1 Gene:CG15408 / 33548 FlyBaseID:FBgn0031523 Length:466 Species:Drosophila melanogaster
Sequence 2:NP_015023.1 Gene:AMF1 / 854560 SGDID:S000005905 Length:515 Species:Saccharomyces cerevisiae


Alignment Length:280 Identity:58/280 - (20%)
Similarity:95/280 - (33%) Gaps:107/280 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   253 LQDAVTFKDFYSRPALKAYGPALVLLIANQFSGLFTMVNYMSDIFANSGSTMDPDTCTIIIG--- 314
            |.|....|.|:   .|..:..||..|:|.     |::  |.:.||.        |.|....|   
Yeast   103 LGDIFGHKKFF---VLGFFWYALWSLLAG-----FSV--YSNQIFF--------DCCRAFQGMGP 149

  Fly   315 ------AVQILG-TYVTTLLCDICGRKLLMLVSTGGVAISLTAFGFFTKYAESHNIGEYSWIPLL 372
                  |:.||| ||..       ||:..|:.|..|.:   ...|||.....|..:|:.:|.|..
Yeast   150 AFLLPNAIAILGRTYKP-------GRRKNMVFSLFGAS---APGGFFLGAVFSSMLGQLAWWPWA 204

  Fly   373 LMSMDI---------------------------------FLGNI-GLVGCFFVSLV-EMFPVKIR 402
            ...|.|                                 |.|:: |:||....:.. ...||...
Yeast   205 YWIMGIACFVLAVAGYFVIPHTPMPSRDASSFKLLERIDFAGSVTGVVGLILFNFAWNQGPVVGW 269

  Fly   403 AKAASMAIVVCSIFVFLML-------NIFPI---------------CMKQWGISATMWSCAGVTA 445
            ....:.|:::...| ||::       ..||:               |:      |..|:..|:. 
Yeast   270 QTPYTYALLIVGTF-FLVIFAYIESRAAFPLLPFAALSSDTAFVLSCI------AAGWASFGIW- 326

  Fly   446 LSSLYFTY-FMKETKGKSML 464
               :::|: ||::::|::.|
Yeast   327 ---IFYTWQFMEDSRGQTPL 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15408NP_608767.1 2A0115 17..410 CDD:273327 43/201 (21%)
MFS 60..455 CDD:119392 54/269 (20%)
AMF1NP_015023.1 MFS_Amf1_MDR_like 48..493 CDD:341029 58/280 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0254
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.