DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15408 and TMT1

DIOPT Version :9

Sequence 1:NP_608767.1 Gene:CG15408 / 33548 FlyBaseID:FBgn0031523 Length:466 Species:Drosophila melanogaster
Sequence 2:NP_001319055.1 Gene:TMT1 / 838676 AraportID:AT1G20840 Length:734 Species:Arabidopsis thaliana


Alignment Length:191 Identity:45/191 - (23%)
Similarity:84/191 - (43%) Gaps:21/191 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 GWLSPTLRKLQSDSPAGFEVKSEFEI----SWVGSMLGMGSVTGNILIGC---LLGRLGSKRCLL 96
            ||.:.|:        ||..|....::    |..|.::.|..:...::..|   :...||.:..|:
plant    19 GWDNATI--------AGAMVYINKDLNLPTSVQGLVVAMSLIGATVITTCSGPISDWLGRRPMLI 75

  Fly    97 LIAIPHSCFWILVYFAQSVEYLYVGRLLAGICGGGMYIVHPILLSEIADANIRGTFSAMVMLSVN 161
            |.::.:....:::.::.:|..|...|||.|...|....:.|:.:||.|...|||..:.:.....:
plant    76 LSSVMYFVCGLIMLWSPNVYVLCFARLLNGFGAGLAVTLVPVYISETAPPEIRGQLNTLPQFLGS 140

  Fly   162 VGILVGYIIG-----THLPYYSIPLMVLILP-LWYLISVLLFIKESPMHLIRIGKYSAAER 216
            .|:.:.|.:.     :..|.:...|.||.:| |.||...:.::.|||..|:..|:...|:|
plant   141 GGMFLSYCMVFTMSLSDSPSWRAMLGVLSIPSLLYLFLTVFYLPESPRWLVSKGRMDEAKR 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15408NP_608767.1 2A0115 17..410 CDD:273327 45/191 (24%)
MFS 60..455 CDD:119392 39/170 (23%)
TMT1NP_001319055.1 MFS 10..>208 CDD:421695 45/191 (24%)
MFS <509..706 CDD:421695
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0254
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR48021
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.