DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15408 and CG17929

DIOPT Version :9

Sequence 1:NP_608767.1 Gene:CG15408 / 33548 FlyBaseID:FBgn0031523 Length:466 Species:Drosophila melanogaster
Sequence 2:NP_650532.2 Gene:CG17929 / 41978 FlyBaseID:FBgn0038415 Length:491 Species:Drosophila melanogaster


Alignment Length:389 Identity:78/389 - (20%)
Similarity:142/389 - (36%) Gaps:108/389 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 FEISW-VGSMLG--MGSVTGNIL-------IGCLLGRLGSKRCLLLIAIPHSCFWILVYFAQSVE 116
            |:.|| :|.:.|  :.|:|...|       :|.|:...||                :::..:..:
  Fly    87 FKCSWFIGVLAGAALASLTMTFLPKLPFYVLGGLMQLTGS----------------IIFTCKPFD 135

  Fly   117 YLYVGRLLAG--ICGGGM-YIVHPILL--SEIADANIRGTFSAMVMLSVNVGILVGYIIGTH--- 173
            |   |.|||.  :.|.|: .|..|.|:  :|:|..|.||...:|....:.:||.:..|..|.   
  Fly   136 Y---GCLLAARYVAGAGIGLITVPFLIHSAEVATDNHRGVSGSMEQCGLALGIAIQVIYDTQWVD 197

  Fly   174 --------------LPYYSIPLMVLILPLWYLISVLLFIKESPMHLIRIGKYSAAERSFRYYKNI 224
                          :.:..|.|.:..|.:           |||::.:||   ...|::.:.:..:
  Fly   198 DKEASVNEVHGIIGIVFSIIGLGMTALSI-----------ESPIYYLRI---KQKEKARKCHAKL 248

  Fly   225 KDSDNIHDQNRAMEEFEIMKIALTKGDALQDAVTFKDFYSRPALKAYGPALVLLIANQFSGLFTM 289
            ..|.| |..::..||.:           |..|.:.|..:.:....:..|.:.||:...|......
  Fly   249 LGSFN-HSVDQEFEEIQ-----------LYVAESQKRTFCQELRISVVPFIKLLLYRGFVAFSFS 301

  Fly   290 VNYMSDIFANSGSTMDPDTC--TIIIGAVQILGTYVTTLLCDICGRKLLMLVSTGGVAISLTAFG 352
            :.....:..::..|....:|  ..:.|.|::||..|.....|..|||.:.||  |.:.:::....
  Fly   302 LPLSESLIKSALLTEGFISCWPVTVWGLVRLLGALVAQGFLDKLGRKFVSLV--GLLCMAILMLC 364

  Fly   353 FFTKYAESHN--------------IGEYSWIPLLLMSMDIFLGNIGLVGCFFVSLVEMFPVKIR 402
            ....||...|              :...::..|.:.|..::||             |.||:|::
  Fly   365 MAASYANPANALMTYYMYQVWRLGLAFQAFAGLFVCSSSVYLG-------------EAFPIKVK 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15408NP_608767.1 2A0115 17..410 CDD:273327 78/389 (20%)
MFS 60..455 CDD:119392 78/389 (20%)
CG17929NP_650532.2 Sugar_tr 67..482 CDD:278511 78/389 (20%)
MFS 295..>425 CDD:119392 26/136 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444522
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0254
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.