DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15408 and srx-118

DIOPT Version :9

Sequence 1:NP_608767.1 Gene:CG15408 / 33548 FlyBaseID:FBgn0031523 Length:466 Species:Drosophila melanogaster
Sequence 2:NP_496675.2 Gene:srx-118 / 188681 WormBaseID:WBGene00006009 Length:328 Species:Caenorhabditis elegans


Alignment Length:241 Identity:54/241 - (22%)
Similarity:84/241 - (34%) Gaps:70/241 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 IGWLS-PTLRKLQSDSPAGF--EVKSEFEISWVGSMLGMGS---VTGNILIGCLLGRLGSKRCL- 95
            ||:|: |....|..|.|..:  ....:| |:|.|..:|..|   :|.|.:|......|..|:.. 
 Worm    70 IGYLAFPVPSLLLEDPPNHWLNAAMGQF-IAWFGWSIGPLSQILLTVNRIIAVYFPLLYMKKYRY 133

  Fly    96 --LLIAIPHSCF--WILV--YFAQSVEYLYVGRLLAGICGGGMYIVHPILLSEIADANIRGTFSA 154
              ..:.|..|.|  :||:  :|.:...||:....|..:                      |.|:.
 Worm   134 NPTNVGIGFSFFVAFILLVSFFPEGCHYLFNRDYLGWV----------------------GEFTP 176

  Fly   155 MVMLSVNVGILVGYIIGTHLPYYSIPLMVLILPLWYLISVLLFIK---ESPMHLIRIGKYSAAER 216
            .:.:.....::|               |:.|..|....|||||||   .||.  .|:.....|.|
 Worm   177 CIDIMQKTFLVV---------------MMTICALTTCCSVLLFIKLIIHSPN--FRVSNAQLANR 224

  Fly   217 SFRYYKNIKDSDNIHDQNRAMEEFEIMKIALTKGDALQDAVTFKDF 262
                          |.:||.:....|::..|...|:|...:|:..|
 Worm   225 --------------HRKNRKLIIQAIVQSILIIVDSLNSTITYNLF 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15408NP_608767.1 2A0115 17..410 CDD:273327 54/241 (22%)
MFS 60..455 CDD:119392 47/216 (22%)
srx-118NP_496675.2 7TM_GPCR_Srx 27..285 CDD:370981 54/241 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D430696at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.