DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3285 and SIT1

DIOPT Version :9

Sequence 1:NP_001285583.1 Gene:CG3285 / 33547 FlyBaseID:FBgn0031522 Length:466 Species:Drosophila melanogaster
Sequence 2:NP_010849.3 Gene:SIT1 / 856644 SGDID:S000000791 Length:628 Species:Saccharomyces cerevisiae


Alignment Length:241 Identity:45/241 - (18%)
Similarity:91/241 - (37%) Gaps:60/241 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   237 DEFEEMKYLLIKEQTEK-----------------AKSF------------DYRDFITRPAFKAYA 272
            :||||   :::.|..||                 |.|:            .|.:...||.::...
Yeast    12 EEFEE---VVVPEMLEKEVGAKVDVKPTLTTSSPAPSYIELIDPGVHNIEIYAEMYNRPIYRVAL 73

  Fly   273 SAAVLLISNQFSASFCVTTYLADVFAAS----HTTLNLGMCTIIIGVLQIVGNYVTTLLCDKYGR 333
            ..::.||:..:.....: .|....:|.|    |:.|:...|  |..|:..||......|.|.:||
Yeast    74 FFSLFLIAYAYGLDGNI-RYTFQAYATSSYSQHSLLSTVNC--IKTVIAAVGQIFFARLSDIFGR 135

  Fly   334 RILMLTSTLGASVCLTAFGTFTFFAEAADLSSVDWLPLVILSCFVFLCNIGLVGCLFVVLVELFP 398
            ..:|:     .|:...:.||.      .:..:|:.....:..||.   .:||.|  .::::|:..
Yeast   136 FSIMI-----VSIIFYSMGTI------IESQAVNITRFAVGGCFY---QLGLTG--IILILEVIA 184

  Fly   399 AKIRSVS---VSTFVVILSSTV--FLTLKIFPICMAVWGTSVTMWS 439
            :...:::   ::.|:..|...:  :::..:.....|.|...:.||:
Yeast   185 SDFSNLNWRLLALFIPALPFIINTWISGNVTSAIDANWKWGIGMWA 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3285NP_001285583.1 MFS 29..443 CDD:119392 45/241 (19%)
MFS_1 32..419 CDD:284993 41/219 (19%)
SIT1NP_010849.3 MFS_ARN_like 70..582 CDD:340880 33/180 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0254
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.