DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3285 and ARN1

DIOPT Version :9

Sequence 1:NP_001285583.1 Gene:CG3285 / 33547 FlyBaseID:FBgn0031522 Length:466 Species:Drosophila melanogaster
Sequence 2:NP_011823.1 Gene:ARN1 / 856345 SGDID:S000001032 Length:627 Species:Saccharomyces cerevisiae


Alignment Length:226 Identity:49/226 - (21%)
Similarity:85/226 - (37%) Gaps:57/226 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   246 LIKEQTEKAKSFDYRDFITRPAFKAYASAAVLLISNQFSASFC------------VTTYLADVFA 298
            ||.:|||          |...|:..:...|:||:    ||..|            :.|..|....
Yeast    56 LIIQQTE----------IIGSAYNKWYLQAILLL----SAFICGYGYGLDGNIRYIYTGYATSSY 106

  Fly   299 ASHTTLNLGMCTIIIGVLQIVGNYVTTLLCDKYGRRILMLTSTLGASVCLTAFGTFTFFAEAADL 363
            :.|:.|:  ...:|..|:......:...|.|.:||..|.:     ::|.|...||. ..::|.|:
Yeast   107 SEHSLLS--TINVINAVVSAASQIIYARLSDVFGRLYLFI-----SAVILYVVGTI-IQSQAYDV 163

  Fly   364 SSVDWLPLVILSCFVFLCNIGLVGCLFVVLVEL--FPA---KIRSVSVSTFVVILSSTVF--LTL 421
            ..        .:......|.|.||.:.::|:.|  |.:   ::....|.|:..|:::.:.  :|.
Yeast   164 QR--------YAAGAIFYNAGYVGVILILLIILSDFSSLKWRLLYQFVPTWPFIINTWIAGNITS 220

  Fly   422 KIFPICMAVWGTSVTMWSCSGITFFSFLYFC 452
            :..|:  ..|...|.||:      |.|...|
Yeast   221 RANPV--VNWSWDVGMWA------FIFPLSC 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3285NP_001285583.1 MFS 29..443 CDD:119392 46/215 (21%)
MFS_1 32..419 CDD:284993 40/191 (21%)
ARN1NP_011823.1 MFS_ARN_like 74..586 CDD:340880 42/198 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0254
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.