DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3285 and ARN2

DIOPT Version :9

Sequence 1:NP_001285583.1 Gene:CG3285 / 33547 FlyBaseID:FBgn0031522 Length:466 Species:Drosophila melanogaster
Sequence 2:NP_011816.2 Gene:ARN2 / 856338 SGDID:S000001039 Length:620 Species:Saccharomyces cerevisiae


Alignment Length:243 Identity:54/243 - (22%)
Similarity:86/243 - (35%) Gaps:80/243 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   226 KNIRKN------DIKAEDEF---EEM-------KYLLIKEQTEKAKSFDYRDFITRPAFKAYASA 274
            ||..||      |.|.:|:.   :||       |.|:|::....||.:|           .:...
Yeast    16 KNTEKNCNELMVDEKMDDDSSPRDEMKDKLKGTKSLIIRKSELMAKKYD-----------TWQLK 69

  Fly   275 AVLLISNQFSASFCVTTYLAD--------VFAASHTTLNLGMCTIIIGVLQI--VGNYVTTLLCD 329
            |:.|    |||..|...|..|        .:|.:..:.:..:.|:.:.||.|  |...:...|.|
Yeast    70 AIFL----FSAFICTFAYGLDSSIRGTYMTYAMNSYSAHSLISTVSVIVLMISAVSQVIFGGLSD 130

  Fly   330 KYGRRILMLTS----TLGASVCLTAFGTFTFFAEAADLSSVDWLPLVILSCFVFLCNIGLVGCLF 390
            .:||..|.|.|    .:|..:...|:....:.|.|.               |.:   :||||.:.
Yeast   131 IFGRLTLFLVSIVLYIVGTIIQSQAYDVQRYAAGAV---------------FYY---VGLVGVML 177

  Fly   391 VVLVELFPAKIRSVSVSTFVVILSSTVFLTLKIFPICMAVWGTSVTMW 438
            .|                 |::||....|..::|...:..|.:.:|.|
Yeast   178 QV-----------------VLMLSDNSSLKWRLFYTLIPSWPSIITTW 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3285NP_001285583.1 MFS 29..443 CDD:119392 54/243 (22%)
MFS_1 32..419 CDD:284993 49/222 (22%)
ARN2NP_011816.2 MFS_ARN_like 69..581 CDD:340880 39/179 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0254
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.