DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3285 and ATR1

DIOPT Version :9

Sequence 1:NP_001285583.1 Gene:CG3285 / 33547 FlyBaseID:FBgn0031522 Length:466 Species:Drosophila melanogaster
Sequence 2:NP_013591.1 Gene:ATR1 / 854924 SGDID:S000004584 Length:542 Species:Saccharomyces cerevisiae


Alignment Length:206 Identity:37/206 - (17%)
Similarity:72/206 - (34%) Gaps:68/206 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FKLRLASVFANPNCLLGRRIRHQFLVTLLLNIATFSHGLGVGWMSPVMRDLQTDESPLDFPVLVS 67
            :::|.|.....|..::  :.||...:.|.|.....|.|:...:.             ..|.:.:.
Yeast   314 YEIRFAKTPLLPRAVI--KDRHMIQIMLALFFGWGSFGIFTFYY-------------FQFQLNIR 363

  Fly    68 QVS--WIGS---LVGIGSVMGNLIAGLLMDRIGRKMVLFFIAIPYTTFWCLIYFVQSVEFLYIGR 127
            |.:  |.|.   :..|..::..|:.|..:..:...:.|||..:.:.                :|.
Yeast   364 QYTALWAGGTYFMFLIWGIIAALLVGFTIKNVSPSVFLFFSMVAFN----------------VGS 412

  Fly   128 LMAGITGGACYVVLPTFISEIADTNVRGRLGSIILLSVNTGV-------------------LAGY 173
            :||.:|             .:.:|..|.:||::|:||....:                   :||.
Yeast   413 IMASVT-------------PVHETYFRTQLGTMIILSFGMDLSFPASSIIFSDNLPMEYQGMAGS 464

  Fly   174 IVSTRVDYFTS 184
            :|:|.|:|..|
Yeast   465 LVNTVVNYSMS 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3285NP_001285583.1 MFS 29..443 CDD:119392 32/180 (18%)
MFS_1 32..419 CDD:284993 31/177 (18%)
ATR1NP_013591.1 MFS_Amf1_MDR_like 73..517 CDD:341029 37/206 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0254
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.