DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3285 and TMT2

DIOPT Version :9

Sequence 1:NP_001285583.1 Gene:CG3285 / 33547 FlyBaseID:FBgn0031522 Length:466 Species:Drosophila melanogaster
Sequence 2:NP_001190923.1 Gene:TMT2 / 829684 AraportID:AT4G35300 Length:739 Species:Arabidopsis thaliana


Alignment Length:222 Identity:54/222 - (24%)
Similarity:102/222 - (45%) Gaps:24/222 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LLLNIATFSHGLGVGWMSP--------VMRDLQTDESPLDFPVLVSQVSWIGSLVGIGSVMGNLI 86
            :|:.||.....|..||.:.        :.::...:.:|....::|:.     ||  ||:.:....
plant     5 VLVAIAAAVGNLLQGWDNATIAGAVLYIKKEFNLESNPSVEGLIVAM-----SL--IGATLITTC 62

  Fly    87 AGLLMDRIGRKMVLFFIAIPYTTFWCLIYFVQSVEFLYIGRLMAGITGGACYVVLPTFISEIADT 151
            :|.:.|.:||:.:|...:|.|.....::.:..:|..|.:|||:.|...|....::|.:|||.|..
plant    63 SGGVADWLGRRPMLILSSILYFVGSLVMLWSPNVYVLLLGRLLDGFGVGLVVTLVPIYISETAPP 127

  Fly   152 NVRGRLGSIILLSVNTGVLAGYIVSTRVDYFTSPPF-----IIGLP--VCYFICNFLIPETPHHL 209
            .:||.|.::...:.:.|:...|.:...:....||.:     ::.:|  |.:|:..|.:||:|..|
plant   128 EIRGLLNTLPQFTGSGGMFLSYCMVFGMSLMPSPSWRLMLGVLFIPSLVFFFLTVFFLPESPRWL 192

  Fly   210 VRKGKFEAAKRSFMFYKNIRKNDIKAE 236
            |.||:...|||.....:.  :.|:..|
plant   193 VSKGRMLEAKRVLQRLRG--REDVSGE 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3285NP_001285583.1 MFS 29..443 CDD:119392 54/222 (24%)
MFS_1 32..419 CDD:284993 53/220 (24%)
TMT2NP_001190923.1 MFS 14..>174 CDD:421695 35/166 (21%)
MFS <516..713 CDD:421695
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0254
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR48021
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.