DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3285 and TMT3

DIOPT Version :9

Sequence 1:NP_001285583.1 Gene:CG3285 / 33547 FlyBaseID:FBgn0031522 Length:466 Species:Drosophila melanogaster
Sequence 2:NP_001190054.1 Gene:TMT3 / 824312 AraportID:AT3G51490 Length:737 Species:Arabidopsis thaliana


Alignment Length:256 Identity:55/256 - (21%)
Similarity:110/256 - (42%) Gaps:27/256 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 IRHQFLVTLLLNIATFSHGLG----VGWMSPVMRDLQTDESPLDFPVLVSQVSWIGSLVGIGSVM 82
            :|...||.|...|.....|..    .|.:..:.::...::.|....::|:.     ||  ||:.:
plant     1 MRSVVLVALAAAIGNMLQGWDNATIAGAVIYIKKEFHLEKEPKIEGLIVAM-----SL--IGATL 58

  Fly    83 GNLIAGLLMDRIGRKMVLFFIAIPYTTFWCLIYFVQSVEFLYIGRLMAGITGGACYVVLPTFISE 147
            ....:|.:.|::||:.:|...::.|.....::::..:|..|...||:.|...|....::|.:|||
plant    59 ITTFSGPVSDKVGRRSMLILSSVLYFLSSIVMFWSPNVYVLLFARLLDGFGIGLAVTLVPIYISE 123

  Fly   148 IADTNVRGRLGSIILLSVNTGVLAGYIVSTRVDYFTSPPF-----IIGLP-VCYFI-CNFLIPET 205
            .|.:.:||.|.:......:.|:...|.:...:....||.:     ::.:| :.||: ..|.:||:
plant   124 TAPSEIRGLLNTFPQFCGSGGMFLSYCLVFGMSLQESPSWRLMLGVLSIPSIAYFVLAAFFLPES 188

  Fly   206 PHHLVRKGKFEAAKRSFMFYKNIRKNDIKAEDEFEEMKYLLIKEQTEKAKSFDYRDFITRP 266
            |..||.||:.:.|::.....:.  :.|:..|       ..|:.|.....|.....:::..|
plant   189 PRWLVSKGRMDEARQVLQRLRG--REDVSGE-------LALLVEGLGVGKDTSIEEYVIGP 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3285NP_001285583.1 MFS 29..443 CDD:119392 52/249 (21%)
MFS_1 32..419 CDD:284993 51/246 (21%)
TMT3NP_001190054.1 MFS 9..>186 CDD:119392 38/183 (21%)
MFS <512..703 CDD:119392
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0254
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR48021
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.