DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3285 and SLC2A2

DIOPT Version :9

Sequence 1:NP_001285583.1 Gene:CG3285 / 33547 FlyBaseID:FBgn0031522 Length:466 Species:Drosophila melanogaster
Sequence 2:NP_000331.1 Gene:SLC2A2 / 6514 HGNCID:11006 Length:524 Species:Homo sapiens


Alignment Length:488 Identity:111/488 - (22%)
Similarity:187/488 - (38%) Gaps:140/488 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LVTLLLNIATFSHGLG-------VGWMSPVMRDLQTDESPLDFPVLVSQVSWIGSLVGIGSVMGN 84
            |:|:|.:::..|..:|       .||:...:..::.        :||:.:.         |::|.
Human    92 LITMLWSLSVSSFAVGGMTASFFGGWLGDTLGRIKA--------MLVANIL---------SLVGA 139

  Fly    85 LIAGLLMDRIGRKMVLFFIAIPYTTFWCLIYFVQSVEFLYIGRLMAGITGGACYVVLPTFISEIA 149
            |:.|  ..::|...:|....             :|:..||.| |::|:        :|.:|.|||
Human   140 LLMG--FSKLGPSHILIIAG-------------RSISGLYCG-LISGL--------VPMYIGEIA 180

  Fly   150 DTNVRGRLGSIILLSVNTGVLAGYIVSTRVDYFTSPPFIIG--------------LPVCYFICNF 200
            .|.:||.||:...|::.||:|...|:...        ||:|              ..:...:..|
Human   181 PTALRGALGTFHQLAIVTGILISQIIGLE--------FILGNYDLWHILLGLSGVRAILQSLLLF 237

  Fly   201 LIPETPHHLVRKGKFEA-AKRSFMFYKNIRKNDIKAEDEFEEMKYLLIKEQTEKAKSFDYRDFIT 264
            ..||:|.:|..|...|. ||:|.   |.:|..|...:|..|..|.   :|:....:........|
Human   238 FCPESPRYLYIKLDEEVKAKQSL---KRLRGYDDVTKDINEMRKE---REEASSEQKVSIIQLFT 296

  Fly   265 RPAFKAYASAAVLL-ISNQFSASFCVTTYLADVFAASHTTLNLGMCTIIIGVLQIVGNYVTTLLC 328
            ..:::.....|::| ::.|||....:..|...:|..:..:..: ..||.:|.:.:|...|:..|.
Human   297 NSSYRQPILVALMLHVAQQFSGINGIFYYSTSIFQTAGISKPV-YATIGVGAVNMVFTAVSVFLV 360

  Fly   329 DKYGRRILMLTSTLGASVCLTAFGTFTFFAEAADLSSVDWLPLVILSCFVFLCNIGLVGC-LFVV 392
            :|.|||.|.|....|..||             |...||.   ||:|:.|.::..:.::.. |||.
Human   361 EKAGRRSLFLIGMSGMFVC-------------AIFMSVG---LVLLNKFSWMSYVSMIAIFLFVS 409

  Fly   393 LVELFPAKIRSVSVSTFVVILSSTVFLTLKIF-----PICMAVWGTSVTMWSCSGITFFSFLY-- 450
            ..|:.|..|              ..|:..:.|     |..:|:  .:.:.|:|:.|....|.|  
Human   410 FFEIGPGPI--------------PWFMVAEFFSQGPRPAALAI--AAFSNWTCNFIVALCFQYIA 458

  Fly   451 -FC----FFL----------------EETNGKS 462
             ||    |||                .||.|||
Human   459 DFCGPYVFFLFAGVLLAFTLFTFFKVPETKGKS 491

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3285NP_001285583.1 MFS 29..443 CDD:119392 97/442 (22%)
MFS_1 32..419 CDD:284993 89/410 (22%)
SLC2A2NP_000331.1 Sugar_tr 14..499 CDD:278511 111/488 (23%)
MFS 98..485 CDD:119392 103/474 (22%)
Monosaccharide binding. /evidence=ECO:0000250|UniProtKB:P11166 314..320 3/5 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144108
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D430696at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X26
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.