DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3285 and SLC2A9

DIOPT Version :9

Sequence 1:NP_001285583.1 Gene:CG3285 / 33547 FlyBaseID:FBgn0031522 Length:466 Species:Drosophila melanogaster
Sequence 2:XP_011512158.1 Gene:SLC2A9 / 56606 HGNCID:13446 Length:615 Species:Homo sapiens


Alignment Length:446 Identity:96/446 - (21%)
Similarity:182/446 - (40%) Gaps:59/446 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 GRRIRHQFLVTLLLNIATFSHGLGVGWM-----------SPVMRDLQTDE------SPLDFPVLV 66
            |.|.|..:..:||  :|:.:...|..::           :|.::....:.      .|:|...|.
Human    45 GGRRRKDWSCSLL--VASLAGAFGSSFLYGYNLSVVNAPTPYIKAFYNESWERRHGRPIDPDTLT 107

  Fly    67 SQVSWIGSLVGIGSVMGNLIAGLLMDRIGRKMVLFF---IAIPYTTFWCLIYFVQSVEFLYIGRL 128
            ...|...|:..||.::|.||..::...:|||..|..   .||.............:.|.|.:||.
Human   108 LLWSVTVSIFAIGGLVGTLIVKMIGKVLGRKHTLLANNGFAISAALLMACSLQAGAFEMLIVGRF 172

  Fly   129 MAGITGGACYVVLPTFISEIADTNVRGRLGSIILLSVNTGVLAGYIVS--TRVDYFTSPPFIIGL 191
            :.||.||....|||.::|||:...:||.||.:..:.:..||..|.::.  ..:...::.|::.|:
Human   173 IMGIDGGVALSVLPMYLSEISPKEIRGSLGQVTAIFICIGVFTGQLLGLPELLGKESTWPYLFGV 237

  Fly   192 PVCYFICNFL----IPETPHHLVRKGKFEA-AKRSFMFYKNIRKNDIKAEDEFEEMKYLLIKEQT 251
            .|...:...|    :|::|.:|:.:...|| |.::|..:  :.|.|:.     :|::.:|.:.:.
Human   238 IVVPAVVQLLSLPFLPDSPRYLLLEKHNEARAVKAFQTF--LGKADVS-----QEVEEVLAESRV 295

  Fly   252 EKA-KSFDYRDFITRPAFK-AYASAAVLLISNQFSASFCVTTYLADVFA-ASHTTLNLGMCTIII 313
            ::: :.....:.:..|..: ...:..|.:...|......:..|...:|. |......:...|:..
Human   296 QRSIRLVSVLELLRAPYVRWQVVTVIVTMACYQLCGLNAIWFYTNSIFGKAGIPPAKIPYVTLST 360

  Fly   314 GVLQIVGNYVTTLLCDKYGRRILMLTSTLGASVCLTAFGTFTFFAEAADLSSVDWLPLV----IL 374
            |.::.:....:.|:.:..|||.|::.   |..:....|||.|......|  ...|:|.:    ||
Human   361 GGIETLAAVFSGLVIEHLGRRPLLIG---GFGLMGLFFGTLTITLTLQD--HAPWVPYLSIVGIL 420

  Fly   375 SCFVFLCNIGLVGCLFVVLVELFPAKIRSVSVSTFVVILSSTV-----FLTLKIFP 425
            :.....|: |..|..|::..|.|....|..:     .|::.||     |....:||
Human   421 AIIASFCS-GPGGIPFILTGEFFQQSQRPAA-----FIIAGTVNWLSNFAVGLLFP 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3285NP_001285583.1 MFS 29..443 CDD:119392 93/436 (21%)
MFS_1 32..419 CDD:284993 88/425 (21%)
SLC2A9XP_011512158.1 2A0115 48..462 CDD:273327 91/433 (21%)
MFS 61..466 CDD:119392 88/422 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144143
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X26
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.