DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3285 and sut2

DIOPT Version :9

Sequence 1:NP_001285583.1 Gene:CG3285 / 33547 FlyBaseID:FBgn0031522 Length:466 Species:Drosophila melanogaster
Sequence 2:NP_524732.1 Gene:sut2 / 44269 FlyBaseID:FBgn0028562 Length:491 Species:Drosophila melanogaster


Alignment Length:486 Identity:113/486 - (23%)
Similarity:188/486 - (38%) Gaps:81/486 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 LVTLLLNIATFSHGLGVGWMSPVM-----------RDLQTDESPLDFPVLVSQ--VSW--IGSLV 76
            |:.|:....|....:.||:...|:           :|:..:|  .|..|...|  :.|  |.|:.
  Fly    18 LLMLICLTVTLGTTIPVGYFFGVLNAPAEIIKKWCQDILANE--YDTIVTAGQLDILWTSIVSIY 80

  Fly    77 GIGSVMGNLIAGLLMDRIGRK------MVLFFIA-IPYTTFWCLIYFVQSVEFLYIGRLMAGITG 134
            .||.:.|:..:.:|.|:.|||      .|||.:: |.:|  ||..  .:|:|.|..||.:.||..
  Fly    81 LIGGICGSCFSAVLCDKYGRKGCLVISSVLFVVSGILFT--WCRA--AKSLEMLMTGRFLGGIAS 141

  Fly   135 GACYVVLPTFISEIADTNVRGRLGSIILLSVNTGVLAGYIV-------STRV-DYFTSPPFIIGL 191
            ...:...|.::.|.|.:.:.|.:|....:.|..|:|...:.       |.|: .|..|  |...|
  Fly   142 ALIFTAQPMYLLESAPSELSGSVGVFTCIGVTGGILLAQVATLSHLLGSERLWPYALS--FYSLL 204

  Fly   192 PVCYFICNFLIPETPHHLVRKGKFEAAKRSFMFYKNIRKNDIKAEDEFEEMKYLLIKEQTEKAKS 256
            .:...:..:..||:|..|....:..||....:.....|..:.:...|..|||      .|.:|||
  Fly   205 VMASLVLLWWFPESPRWLYLHKRDSAASEKALLRLRGRNTEEEVHQELLEMK------ATLEAKS 263

  Fly   257 FDYRDFITRPAFKAYASAAVLLISNQFSASFCVTTYLADVFA----------------ASHTTLN 305
            ......:......:.....:||:     .||..|..|:.:.|                .:.|.||
  Fly   264 SSEVSSLCSVLRNSELWLPLLLV-----CSFQATQQLSGINAIFFYSLSILTNAGFSDGAATWLN 323

  Fly   306 LG-----MCTIIIGVLQIVGNYVTTLLCDKYGRRILMLTSTLGASVCLTAFGTFTFFAEAADLSS 365
            ||     :||.::|          .||..::.||.||:.|....::.|.|.....||.|.::.:.
  Fly   324 LGIGSFNLCTSLLG----------PLLIRRFPRRPLMMISCSMCALALLAMSLGLFFLERSESTV 378

  Fly   366 VDWLPLVILSCFVFLCNIGLVGCLFVVLVELFPAKIRSVSVSTFVVILSSTVFLTLKIFPICMAV 430
            :.:.....:..|:....:||....:.:..||.....|.|::|...:......||....||:..:|
  Fly   379 LTYFCAAFILTFILGFQLGLGPIAYFIGSELLEDSPRPVAMSMGSLFSWIGNFLVGMCFPLLQSV 443

  Fly   431 WGTSVTMWSCSGITFFSFLYFCFFLEETNGK 461
            | :|.....|..:..:..|....:|.||.|:
  Fly   444 W-SSFAFIPCMCVCIYCLLLTWRYLPETRGR 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3285NP_001285583.1 MFS 29..443 CDD:119392 107/464 (23%)
MFS_1 32..419 CDD:284993 98/437 (22%)
sut2NP_524732.1 Sugar_tr 23..473 CDD:278511 110/479 (23%)
MFS 76..466 CDD:119392 97/417 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444464
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.