DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3285 and CG17930

DIOPT Version :9

Sequence 1:NP_001285583.1 Gene:CG3285 / 33547 FlyBaseID:FBgn0031522 Length:466 Species:Drosophila melanogaster
Sequence 2:NP_650533.1 Gene:CG17930 / 41979 FlyBaseID:FBgn0038416 Length:502 Species:Drosophila melanogaster


Alignment Length:486 Identity:107/486 - (22%)
Similarity:170/486 - (34%) Gaps:159/486 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 TLLLNIATFSHGLGVGWMSPVMRDLQTDESPLDFPVLVSQVSW-----IGSLV------------ 76
            |||...|......|:||....:     ..:.|:|     |.||     ||::|            
  Fly    69 TLLFVYAGMDMAQGLGWNLTAV-----SANTLEF-----QYSWFIGVIIGAVVSAITSAFLPKIV 123

  Fly    77 --GIGSVMGNLIAGLLMDRIGRKMVLFFIAIPYTTFWCLIYFVQSVEFLYIGRLMAGITGGACYV 139
              |:|.|| |||..::           |::.||           ..|.:...|.:.|:  |...:
  Fly   124 FYGLGGVM-NLIDAII-----------FVSAPY-----------EYESILAARYVGGV--GIGLI 163

  Fly   140 VLPTFI--SEIADTNVRGRLGSIILLSVNTGVLAGYIVST-----------RVD-----YFT--- 183
            .:|..|  :|||.:..||...::....:..||....|..:           ||.     .||   
  Fly   164 TVPFLIHSAEIASSTNRGTCCALEQYGLALGVAIQVIYDSQWSQGLGMTINRVHGIFGIVFTAIA 228

  Fly   184 --SPPFIIGLPVCYFICNFLIPETPHHLVRKGKFEAAKRSFMFYKNIRKNDIKAEDEFEEMKYLL 246
              |....|..|:.|...|           ::.|..|:.:..|.....|:...:|.||.:  .|::
  Fly   229 LGSVAITIDSPIFYIRQN-----------QEQKARASVKQLMGSYWTREAGDRAYDEAK--LYVV 280

  Fly   247 ------IKEQTEKAKSFDYRDFITRPAFKAYASAAVLLISNQFSASFCVTTYLADVFAASHTTLN 305
                  :.||..::    ...|:....|:.:.:   ...|...|.|...||.|.:      .||:
  Fly   281 EGSAQGVGEQLGES----MMPFLKLLLFRCFVA---FTFSVPLSYSILTTTELVE------GTLH 332

  Fly   306 LGMCTIIIGVLQIVGNYVTTLLCDKYGRRILMLTS-------TLGASVCLTAFG----------- 352
             ...|||.|:|:::|..:|..:.|..||:.:.|..       .||.:.....:|           
  Fly   333 -SWPTIIFGLLRLIGALITFAVLDTVGRKFVSLLGLMCMAGLMLGMAGVYGDYGHIFDDYFMWQV 396

  Fly   353 -----TFTFFAEAADLSSVDWL----PLVILSCFVFLCNIGLVGCL-----FVVLVELFPAK--- 400
                 .|.|||.....||..:|    |:.:..   ||  |||:.||     .:|:|:..|..   
  Fly   397 CRLGMAFQFFAGFFICSSSAYLGEAFPMRVKP---FL--IGLIVCLEQVIHIIVIVKFVPTAEFY 456

  Fly   401 ---------IRSVSVSTFVVILSSTVFLTLK 422
                     |..:.:..|.|::..|..|||:
  Fly   457 YTYFVAVGIIMVIGLVAFAVLMPETRGLTLR 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3285NP_001285583.1 MFS 29..443 CDD:119392 107/486 (22%)
MFS_1 32..419 CDD:284993 101/478 (21%)
CG17930NP_650533.1 Sugar_tr 102..493 CDD:278511 95/443 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444495
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0254
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.