DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3285 and CG14160

DIOPT Version :9

Sequence 1:NP_001285583.1 Gene:CG3285 / 33547 FlyBaseID:FBgn0031522 Length:466 Species:Drosophila melanogaster
Sequence 2:NP_648380.2 Gene:CG14160 / 39177 FlyBaseID:FBgn0036066 Length:483 Species:Drosophila melanogaster


Alignment Length:454 Identity:92/454 - (20%)
Similarity:169/454 - (37%) Gaps:114/454 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 VSWIGSLVGIGSVMGNLIAGLLMDRIGRKMV------LFFIA------IPYTTFWCLIYFVQSVE 121
            :||.     ||:.:|.|:|.|.:.|:.:.:.      |..||      :| ..|....|...||.
  Fly    66 MSWF-----IGAAVGALLAALFVQRVTKNVAYTSSGFLMIIAGILNVVLP-QHFLAACYSSVSVG 124

  Fly   122 FLY-IGRLMAGITGGACYVVLPTFISEIADTNVRGRLGSIILLSVNTGVLAGYIVSTRVDYFTSP 185
            ..| :.::.|.:||           ||:|..::||.|.|...:.:..||.. .:..|||.:...|
  Fly   125 AAYGLTQIQALVTG-----------SEVAHKSIRGMLLSCEKIFLWLGVCM-QVFYTRVWHNLRP 177

  Fly   186 ---------------PFIIGL---PVCYFICNFLIPETPHHLVRKGKFEAAKRSFMFYKNIRKND 232
                           ..:.||   .|...:.:.|  |:|..|:.:      :|.....:.::...
  Fly   178 LDTQGYEMHIDQLHGMVLAGLGLGAVILALAHRL--ESPLLLLHQ------ERDMAVGETLKALH 234

  Fly   233 IKAEDEF----EEMKYL--------LIKEQTEKAKSFDYRDFITR--PAFKA--YASAAVLLISN 281
            .::..|.    |:.:.|        .::|..|...  |:|.:..|  |.||.  ....|.|.:|.
  Fly   235 GQSTTELVRLREDCRQLHSARDWERFVEEPEESVA--DWRVWARRILPFFKVLLLRCFATLAVSL 297

  Fly   282 QFSASFCVTTYLADVFAASHTTLNLGM-CTIIIGVLQIVGNYVTTLLCDKYGRRILMLTSTLGAS 345
            .::.:|.|.::..         |...| |...:....::|:.:...:.|..|||.:...|...|.
  Fly   298 SYNRAFVVVSWHG---------LECDMNCMYWLAFAGLIGSVLGAFVVDWQGRRKVCSLSLFLAG 353

  Fly   346 VCLTAFGTFTFFAEAADLSSVDWLPLVILSCFVFLCNIGLVGCL----FVVLVELFPAKIRSVSV 406
            |.:...|......|:...|..| :.|::::..:.|..:.:.|.:    .|...|.|....::..:
  Fly   354 VVIVMVGGVFDHLESVKRSFYD-INLLVIALLMLLFEVIVAGGVAVPALVYTAEAFSIAHKARCL 417

  Fly   407 STFVVI--------LSSTV--FLTLKIFPICMAVWGTSVTMWSCSGITFFSF--------LYFC 452
            :..:::        |.:|.  ::|:.:|...:.|:...|      |:|.|.|        ||.|
  Fly   418 AGILIVEQLLQLGLLLATFEHYITVSVFFFTIGVFSFIV------GLTVFMFMPETRQLTLYEC 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3285NP_001285583.1 MFS 29..443 CDD:119392 85/435 (20%)
MFS_1 32..419 CDD:284993 81/411 (20%)
CG14160NP_648380.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444413
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0254
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.