DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3285 and Slc2a6

DIOPT Version :9

Sequence 1:NP_001285583.1 Gene:CG3285 / 33547 FlyBaseID:FBgn0031522 Length:466 Species:Drosophila melanogaster
Sequence 2:NP_001100032.1 Gene:Slc2a6 / 296600 RGDID:1309317 Length:321 Species:Rattus norvegicus


Alignment Length:295 Identity:56/295 - (18%)
Similarity:122/295 - (41%) Gaps:36/295 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   193 VCYFICNFLIPETPHHLVRKGKFEAAKRSFMFYKNIRKNDIKAEDEFEEMKYLLIKEQTEKAKSF 257
            |...:.:|: |.:|..|:.|.:.|.|.::.::.    :.|.:...|||:::..:.::.:..:.:.
  Rat    23 VMILLLSFM-PNSPRFLLSKSRDEEALQALIWL----RADSEVHWEFEQIQDNVRRQSSRVSWAE 82

  Fly   258 DYRDFITRPAFKAYASAAVLLISNQFSASFCVTTYLADVFAASHTTLNLGMCTIIIGVLQIVGNY 322
            .:...:.||..    ...::....|.:....:..||..:|.::...|.......|:|.::::...
  Rat    83 AWEPRVYRPIL----ITVLMRFLQQLTGITPILVYLQTIFDSTSVVLPSQQDAAIVGAVRLLSVL 143

  Fly   323 VTTLLCDKYGRRILMLTSTLGASVCLTAFGTFTFFAE------------------------AADL 363
            :..:..|..||::|:..|   ||:...|..|...:.:                        ||..
  Rat   144 IAAVTMDLAGRKVLLYVS---ASIMFVANLTLGLYVQLVPRTLTPNSTVEIVTLGGTEQPPAAAF 205

  Fly   364 SSVDWLPLVILSCFVFLCNIGLVGCLFVVLVELFPAKIRSVSVSTFVVILSSTVFLTLKIFPICM 428
            :.:..:||:....|:....:|.....::::.|:.|.:.|.|:....|::...|.|:..|.|.:.:
  Rat   206 NYLTLIPLLATMLFIMGYAMGWGPITWLLMSEVLPLRARGVASGLCVLVSWLTAFVLTKYFLLAV 270

  Fly   429 AVWGTSVTMWSCSGITFFSFLYFCFFLEETNGKSL 463
            ..:|..|..:..|.|...|.|:....:.||.|:||
  Rat   271 NAFGLQVPFFFFSAICLLSLLFTGCCVPETRGRSL 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3285NP_001285583.1 MFS 29..443 CDD:119392 48/273 (18%)
MFS_1 32..419 CDD:284993 42/249 (17%)
Slc2a6NP_001100032.1 MFS <89..293 CDD:119392 39/210 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166337881
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0254
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53651
OrthoDB 1 1.010 - - D430696at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X26
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.760

Return to query results.
Submit another query.