Sequence 1: | NP_001285583.1 | Gene: | CG3285 / 33547 | FlyBaseID: | FBgn0031522 | Length: | 466 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_496675.2 | Gene: | srx-118 / 188681 | WormBaseID: | WBGene00006009 | Length: | 328 | Species: | Caenorhabditis elegans |
Alignment Length: | 213 | Identity: | 46/213 - (21%) |
---|---|---|---|
Similarity: | 81/213 - (38%) | Gaps: | 62/213 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 46 MSPVMRDLQTDESPLDFPVLVSQVSWIGSLVGIGSVMGNLIAGLLMDRIGRKMVLFFIAIPYTTF 110
Fly 111 WCLIYFVQSVEFLYIGRLMAGITGGACYVVL-------PTFISEIADTN-VRGRLG--------- 158
Fly 159 ----SIILLSVNTGVLAGYIVSTRVDYFTSPPFIIGLPVCYFICNFLI----PETPHHLVRK--- 212
Fly 213 ---GKF----EAAKRSFM 223 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG3285 | NP_001285583.1 | MFS | 29..443 | CDD:119392 | 46/213 (22%) |
MFS_1 | 32..419 | CDD:284993 | 46/213 (22%) | ||
srx-118 | NP_496675.2 | 7TM_GPCR_Srx | 27..285 | CDD:370981 | 39/187 (21%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D430696at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |