DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3285 and srx-118

DIOPT Version :9

Sequence 1:NP_001285583.1 Gene:CG3285 / 33547 FlyBaseID:FBgn0031522 Length:466 Species:Drosophila melanogaster
Sequence 2:NP_496675.2 Gene:srx-118 / 188681 WormBaseID:WBGene00006009 Length:328 Species:Caenorhabditis elegans


Alignment Length:213 Identity:46/213 - (21%)
Similarity:81/213 - (38%) Gaps:62/213 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 MSPVMRDLQTDESPLDFPVLVSQVSWIGSLVGIGSVMGNLIAGLLMDRIGRKMVLFFIAIPYTTF 110
            ||.|:.:....|........||.|..|...: |||:|.               ||.|||    ||
 Worm     1 MSSVLDEFLYSEFSTPSTRTVSAVMLIVVSI-IGSIMN---------------VLIFIA----TF 45

  Fly   111 WCLIYFVQSVEFLYIGRLMAGITGGACYVVL-------PTFISEIADTN-VRGRLG--------- 158
            :.:   .:...||   ::....:.|:|.|.:       |:.:.|....: :...:|         
 Worm    46 FRV---TKRDGFL---KICCFNSFGSCIVCIGYLAFPVPSLLLEDPPNHWLNAAMGQFIAWFGWS 104

  Fly   159 ----SIILLSVNTGVLAGYIVSTRVDYFTSPPFIIGLPVCYFICNFLI----PETPHHLVRK--- 212
                |.|||:||. ::|.|.....:..:...|..:|:...:|:...|:    ||..|:|..:   
 Worm   105 IGPLSQILLTVNR-IIAVYFPLLYMKKYRYNPTNVGIGFSFFVAFILLVSFFPEGCHYLFNRDYL 168

  Fly   213 ---GKF----EAAKRSFM 223
               |:|    :..:::|:
 Worm   169 GWVGEFTPCIDIMQKTFL 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3285NP_001285583.1 MFS 29..443 CDD:119392 46/213 (22%)
MFS_1 32..419 CDD:284993 46/213 (22%)
srx-118NP_496675.2 7TM_GPCR_Srx 27..285 CDD:370981 39/187 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D430696at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.