DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3285 and K09C4.2

DIOPT Version :9

Sequence 1:NP_001285583.1 Gene:CG3285 / 33547 FlyBaseID:FBgn0031522 Length:466 Species:Drosophila melanogaster
Sequence 2:NP_001361999.1 Gene:K09C4.2 / 187193 WormBaseID:WBGene00019548 Length:152 Species:Caenorhabditis elegans


Alignment Length:100 Identity:26/100 - (26%)
Similarity:42/100 - (42%) Gaps:21/100 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   373 ILSCFVFLCNIGLVGCLFVVLVELFPAKIRSVSVSTFVVILSSTVFL-TLKIFPICMAVWGTSVT 436
            |.|..|.......:..|||  .||||...|:| |...::..|..|.: .:.:|||..:::     
 Worm     4 ITSTVVPATGANAIRLLFV--TELFPPSARTV-VGQAMLFGSMAVGMPVVSLFPIINSIF----- 60

  Fly   437 MWSCSGITFFSF--------LYFCFFLEETNGKSL 463
                |.|.|..|        :|...::.||.|:::
 Worm    61 ----SPIFFVPFVIVQTVFGIYLYRYMPETRGRAV 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3285NP_001285583.1 MFS 29..443 CDD:119392 19/70 (27%)
MFS_1 32..419 CDD:284993 15/45 (33%)
K09C4.2NP_001361999.1 MFS <11..89 CDD:391944 22/89 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158050
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.