DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3285 and Slc2a13

DIOPT Version :9

Sequence 1:NP_001285583.1 Gene:CG3285 / 33547 FlyBaseID:FBgn0031522 Length:466 Species:Drosophila melanogaster
Sequence 2:NP_598295.2 Gene:Slc2a13 / 171147 RGDID:621814 Length:637 Species:Rattus norvegicus


Alignment Length:297 Identity:73/297 - (24%)
Similarity:128/297 - (43%) Gaps:33/297 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 IGSLVGIGSVMGNLIAGLLMDRIGRKMVLFFIAIPYTTFWCLIYFVQSVEFLYIGRLMAGITGGA 136
            :...||..:|.. |..|.|...:||:..:...:...|....::....:.|.|..|||:.|:..|.
  Rat   113 VSGAVGAAAVAA-LAGGALNGALGRRSAILLASALCTVGSAVLAAAANKETLLAGRLVVGLGIGI 176

  Fly   137 CYVVLPTFISEIADTNVRGRLGSIILLSVNTGVLAGYIVSTRVDYFTSP--PFIIGLPVCYFICN 199
            ..:.:|.:|:|::..|:||||.:|..|.:..|.....:|.....|....  .:::||.....:..
  Rat   177 ASMTVPVYIAEVSPPNLRGRLVTINTLFITGGQFFASVVDGAFSYLQKDGWRYMLGLAAIPAVIQ 241

  Fly   200 FL----IPETPHHLVRKGKFEAAKRSFMFYKNIRKNDIKAEDEFEEMKYLLIKEQTEKAKSFDYR 260
            ||    :||:|..|::||:.:.|:|   ....:|.|. ..::|::.::..:.:|:.|.:.:   .
  Rat   242 FLGFLFLPESPRWLIQKGQTQKARR---ILSQMRGNQ-TIDEEYDSIRNSIEEEEKEASAA---G 299

  Fly   261 DFITR-----PAFKAYASAAVLLISNQFSASFCVTTYLADVFAASHTTLNLGM----CTIIIGVL 316
            ..|.|     |..:|.|....|.:..|.|....:..|.|.:...|      |:    ..|.:..:
  Rat   300 PIICRMLSYPPTRRALAVGCGLQMFQQLSGINTIMYYSATILQMS------GVEDDRLAIWLASI 358

  Fly   317 QIVGNYVTTL----LCDKYGRRILMLTSTLGASVCLT 349
            ....|::.||    |.:|.|||.|...|..|.:|.||
  Rat   359 TAFTNFIFTLVGVWLVEKVGRRKLTFGSLAGTTVALT 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3285NP_001285583.1 MFS 29..443 CDD:119392 73/297 (25%)
MFS_1 32..419 CDD:284993 73/297 (25%)
Slc2a13NP_598295.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 16..38
MFS 75..580 CDD:119392 73/297 (25%)
Sugar_tr 78..598 CDD:278511 73/297 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166337835
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0254
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53651
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.