DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8837 and SIT1

DIOPT Version :9

Sequence 1:NP_001285582.1 Gene:CG8837 / 33545 FlyBaseID:FBgn0031520 Length:485 Species:Drosophila melanogaster
Sequence 2:NP_010849.3 Gene:SIT1 / 856644 SGDID:S000000791 Length:628 Species:Saccharomyces cerevisiae


Alignment Length:243 Identity:48/243 - (19%)
Similarity:94/243 - (38%) Gaps:66/243 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   227 PEYLSELN------EFHAELRSRDKNVGSTPMSHGYIIRLTFVSFLLTVCAKLSGVFVELNYAAD 285
            |.|:..::      |.:||:.:|       |:   |.:.|.|..||:.....|.|   .:.|...
Yeast    44 PSYIELIDPGVHNIEIYAEMYNR-------PI---YRVALFFSLFLIAYAYGLDG---NIRYTFQ 95

  Fly   286 FLGRTGYSTETNYVVLASAQCAGALLARLVGPRLPRKLLLCLSSLFAAAAVIALA-LFKAYGHLW 349
            ....:.||   .:.:|::..|...::| .||    :.....||.:|...:::.:: :|.:.|.: 
Yeast    96 AYATSSYS---QHSLLSTVNCIKTVIA-AVG----QIFFARLSDIFGRFSIMIVSIIFYSMGTI- 151

  Fly   350 LLGNWADRYLPIILLAI-----QLALVSFGLYPLAAVVSSEVLPTKLHDLLYSLASAVSWLLLFG 409
                ...:.:.|...|:     ||.|.  |:..:..|::|:.             |.::|.||..
Yeast   152 ----IESQAVNITRFAVGGCFYQLGLT--GIILILEVIASDF-------------SNLNWRLLAL 197

  Fly   410 MIEAF-------------NAVKATIAPGLLLYLWVFAGASIFVGLISL 444
            .|.|.             :|:.|....|:.::.::...|.|.:|:..|
Yeast   198 FIPALPFIINTWISGNVTSAIDANWKWGIGMWAFILPLACIPLGICML 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8837NP_001285582.1 MFS 54..>192 CDD:119392
Sugar_tr 58..453 CDD:278511 48/243 (20%)
SIT1NP_010849.3 MFS_ARN_like 70..582 CDD:340880 40/207 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0254
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.